DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and R03G8.3

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans

Alignment Length:655 Identity:136/656 (21%)
Similarity:240/656 (37%) Gaps:186/656 (28%)


  Fly    97 LKQYVLHVDEEVLHKLSQ--------SKSNKFACFYQNITYG----------------QSADHYD 137
            |.||.:. |:|:|..|:.        :||.:...|..|.::|                :.::.|:
 Worm    73 LPQYDIW-DDEILPYLNMEVNPISNCNKSREPLTFLNNGSWGVVNKKTKLICRARCHTRKSERYN 136

  Fly   138 RMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSFVQYQ--KTSP-----------NLD 189
            .:|..| :|..   |:|.:.:...|..|      ::|.:.|:..|  .|.|           |.|
 Worm   137 VIGNWT-YTPG---PINCEVVEAVCADG------KKDVYGFLHTQVIATPPKQPTVKVSELKNYD 191

  Fly   190 IDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGY-NKVADNTYPNIFSILTGYSPNS 253
            :    :|||  :|::|.|..:|.:.....::.:.....:..| |||.||:.||..::..|.|...
 Worm   192 V----TVIM--LDSLSFTQAKRSLLRTISYMTNHMDAVLFPYINKVGDNSRPNGAALWFGKSLEK 250

  Fly   254 AKNQICDTTQPGCLDKIPFIW-----------------KDMKKNGYLTAYAEDTVFSNIFNYMK- 300
            ....:.:.      :.:|..|                 |:.:..||.|..|||.. ....|:.. 
 Worm   251 LDRSLFEE------ENVPVDWSHAYMCHVYKDNETSLFKEYQNYGYKTLMAEDWA-EGTLNWPNC 308

  Fly   301 PGFLSRPTDYYFRPLLDALEKET-----IKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVAD 360
            .||...|.|:..||..:|||:..     .|.:....|  ||   |..:..:.||..||:..| .|
 Worm   309 KGFDKPPIDHLMRPFQNALERANHGEPLTKSHLKNQK--YC---REDHHTLLDYLSQFINAY-PD 367

  Fly   361 RPIWGFFWSNHISHD----------DFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRF 415
            :..:.:.|::.:.||          ||       ||.:     .:.....:::.:.|..|||.||
 Worm   368 QNKFRWIWASILGHDSENGFPHSDKDF-------HKFL-----IKHREQLDNSFVFFMGDHGLRF 420

  Fly   416 GPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVE 480
            |.:.:|....|:...|.:.:.:|...|:. ...:..:.:|..::.::||...|:..|:..:....
 Worm   421 GNVRKTFVGTLDVSNPFLAVSIPKNLRQT-TGLLNVMRENAQKIQTHFDTRATMLDILKYQSASN 484

  Fly   481 DTK-----------WSYDCPQCQSLFYELPESRSCSEAAIPEAYCTCHNYE-------------- 520
            .|.           :||...|...|       |:|....||..||.|...:              
 Worm   485 FTDLDPLIIPGEKGYSYIRTQPDIL-------RNCRNMPIPMQYCICQFNKTQVSTKSETAKGVG 542

  Fly   521 ---------EVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSL 576
                     |::|...|.:..::.||.:...||:.  |....|:....|    |.:|:..:.|  
 Worm   543 EAVALAVNNEIEEGKFTDKCVKMKVDHVVSLLQFD--QKFKGSMLYTAV----VEMTKPSKAV-- 599

  Fly   577 GKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCIC- 640
                  |....::.:|              .|::: :.::.|.|.|...|.|:.....:.:|.| 
 Worm   600 ------YKANVKILEN--------------GEVKV-LGMVERSNKYGSTAYCIGSEHHRPYCYCK 643

  Fly   641 -LSKL 644
             .|||
 Worm   644 NQSKL 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 108/527 (20%)
ALP_like 190..480 CDD:293745 72/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50142
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.