DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and F10C2.3

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_506015.2 Gene:F10C2.3 WormBaseID:WBGene00008644 Length:604 Species:Caenorhabditis elegans

Alignment Length:656 Identity:171/657 (26%)
Similarity:279/657 (42%) Gaps:103/657 (16%)


  Fly    21 FILFLLIVWKITSYGVNDVL---TIKYNENQKRFYV-----NSSNCQMAYVEPFNAEFTKLYTPK 77
            |:||.|..   |.:...|:.   ||..|...:|...     :||.|.:..::|::....: |...
 Worm     8 FVLFFLCT---TVFLFPDLFASSTISRNLKTRRSVARQKQNSSSKCVVPTLDPWDQSILE-YVLD 68

  Fly    78 NFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLSQS----KSNKFACFYQNITYGQSADHYDR 138
            :.:|.:.    :..| |:.::..:..:||..:.:|:.:    .|.|..|.|:.         ||:
 Worm    69 DGSRPTQ----LACH-DAKVQPELTFLDENGVLQLNSTAVSESSLKVECQYRT---------YDK 119

  Fly   139 M-GKKTKFTHDYVVPLNVQGML------VECRSG--DEKRILQEDAFSFVQYQKTSPNLDIDRKA 194
            | |...:..:...:..|:...:      |.|:..  ...::...:....:...::.|   :..|:
 Worm   120 MDGDDEQLNYSEWISFNMSVKIESEFVEVSCQRAWFPRTKVYSNNHNQIIPISRSQP---VSDKS 181

  Fly   195 SVIMYGIDTVSRTNLRRLMPVVFGFLKS-PGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQI 258
            |||:..:|:||.:|.||.|......:.| .|.:...|..|:.||::.|......|...|:   :.
 Worm   182 SVIVIVLDSVSHSNFRRTMNKTLDVMHSLYGSFIFDGMTKIGDNSFSNAVGFFAGKWWNT---EF 243

  Fly   259 CDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKET 323
            .|.  .|..|....|||..::|||.|.||||....|:|||:..||..:|.|:||||         
 Worm   244 GDA--HGYFDDHDLIWKHYRENGYRTLYAEDYPGFNLFNYLSKGFKKKPVDHYFRP--------- 297

  Fly   324 IKLYCPGCKMVY--------CLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSML 380
               |.......|        |.|....::...:|..||:.:| .|:|.:...|...:.||..:.:
 Worm   298 ---YWLNVYWTYVHRRSRNLCYGNHRMHNLQLNYLSQFVSKY-KDQPKFAISWLTELGHDWLNQV 358

  Fly   381 SAMQHKIVGDLLNFEKD--GSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFRE 443
            .....    ||.||.|.  ...|::.:...||||.||..:.:|....||||.|...:.||...| 
 Worm   359 RYGDE----DLANFLKKHVEDLENSYLFIMSDHGHRFDNIRKTSIGRLEERLPFFSVSLPKKLR- 418

  Fly   444 KYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKWSYDCPQCQSLFYELP-ESRSCSEA 507
            |..:.|:.:.:|..:|:|.||:|.|.:||:|      ::| ..|..:.:|||  || :.|:|..|
 Worm   419 KDSKLVDTVRKNSKKLTSFFDVYATFRHILN------NSK-QPDVMRGESLF--LPIKDRNCETA 474

  Fly   508 AIPEAYCTCHNYE--EVQEDHGTWRMAELVVDRINQFLQYHNLQNLCSSLTLK-LVNITEVRITE 569
            .|||.:|.|....  .|..:.....|||.....|||.|..|   ..|..|.|| ::::::|...:
 Worm   475 HIPEEFCVCDTEVPLNVSANAQIRTMAEDFAKDINQRLDPH---PQCVQLYLKNVISVSQVGDVK 536

  Fly   570 SDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQ 634
            .          :.|....:|..:.|.|.|.:|||....:..: :..|:|||.|...:.|:.|...
 Worm   537 E----------QRYRFTIEVSPSNAIFEALLLYDPFESQTTV-IGDINRINKYGNQSLCVQDQFL 590

  Fly   635 KLFCIC 640
            :..|.|
 Worm   591 RKLCFC 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
F10C2.3NP_506015.2 DUF229 110..527 CDD:281053 130/464 (28%)
ALP_like 182..451 CDD:293745 91/298 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.