DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and Y38A10A.2

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_504570.2 Gene:Y38A10A.2 WormBaseID:WBGene00021389 Length:599 Species:Caenorhabditis elegans

Alignment Length:629 Identity:123/630 (20%)
Similarity:241/630 (38%) Gaps:176/630 (28%)


  Fly    31 ITSYGVNDVLTIKYNENQKRFYVNSSNCQMAYVEPFNAEFTKLYTPKNFTR--CSNQSDLVTVHF 93
            :.:|..:.:|   |||           |....::|:..:..| |..|...|  |.:..|:.....
 Worm    41 LPNYNAHPIL---YNE-----------CTWPILDPYEPDILK-YIKKRNRRLACRSSPDVEVEWL 90

  Fly    94 DSILKQYVLHVDEEVLHKLSQSKSNKFACFYQNITYGQSADHYDRMGKKTKFTHDYVVPLNVQGM 158
            ||.:             :::...:|..:|...::: |.||:....:....|...|:.:.:.....
 Worm    91 DSKI-------------QITLKSANVMSCVASDLS-GFSANEDVFVSPAIKLEADFPLEIPYTNF 141

  Fly   159 LVECRSGDEKRILQEDAFSFVQYQK--------------TSPNLDIDRKASVIMYGIDTVSRTNL 209
            .|||.. :.|||.::   ||..|:|              |||::       .::| :.::|.:.|
 Worm   142 AVECEQ-NGKRIYRK---SFYNYKKDQAEKPVEAMESTPTSPSI-------AVLY-LRSMSHSQL 194

  Fly   210 RRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSILTGYSPNSAKNQICDTTQPGCLDKIPFIW 274
            :|..|......:..|:|:...:||::|    ||..|:.|                      .|..
 Worm   195 QREFPKTVKASRKFGFYDFAMFNKISD----NITDIVNG----------------------TFWH 233

  Fly   275 KDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGR 339
            ||::..  :..|.::..|..:|:  .......|:||.......:|:.::       |.....:..
 Worm   234 KDVRHT--VGEYMKNERFCKVFS--NTNLSGVPSDYDISNWAHSLKSDS-------CSDDDSVSE 287

  Fly   340 RLANSYI------FDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDG 398
            ||...:.      .|:|  ::.....:..||.      .|.||  .||::.::       |:.:.
 Worm   288 RLIEQWAQFSIHNTDHC--YLSHIFVNNTIWS------KSLDD--TLSSVMNQ-------FQLNE 335

  Fly   399 SFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNF 463
            .|::|:::..|..|...|....:....:|||.||:..::|...::.|..:|..|..|||||.::.
 Worm   336 VFKNTLVVVVSAEGIPVGTFGNSYTGKVEERNPILLAHIPDKVKKLYSDHVFHLESNQNRLITHL 400

  Fly   464 DIYNTL------------------------KHIINIEGLVEDTKWSYDCPQCQSLFYELPESRSC 504
            ::::.|                        ||:..|      :.|       |:|   :|.:|:|
 Worm   401 EVFDLLTSFSRLSKNQVIVPVLDDFMDWKRKHVRGI------SPW-------QTL---IPRNRTC 449

  Fly   505 SEAAIPEAYCTCHNYE-EVQEDHG-TWRMAELVVDRINQFLQYHNLQNL-CSSLT--------LK 558
            ....|.:.:|.|.:.: :::.::. |:.:|:.:.|::...:    |.|. |...|        ..
 Worm   450 YHVPIADEFCLCMDRKMDIEREYNQTFAIAQRLYDKMESDI----LSNYSCMHETTWIEERNYTS 510

  Fly   559 LVNITEVRITESDEHVS-LGKGLRHYHTKFQVHQNLAEFFATVL 601
            :.|:.|..:..::|::. |..|:|.:..|.   ..|..||..||
 Worm   511 VYNLNEKVLNGTEEYIEFLIFGVRAFPKKI---NRLGNFFVNVL 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
Y38A10A.2NP_504570.2 DUF229 72..465 CDD:281053 95/489 (19%)
ALP_like 179..405 CDD:304875 57/288 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.