DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and Y73F8A.35

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001255870.1 Gene:Y73F8A.35 WormBaseID:WBGene00013539 Length:654 Species:Caenorhabditis elegans

Alignment Length:672 Identity:147/673 (22%)
Similarity:254/673 (38%) Gaps:157/673 (23%)


  Fly    65 PFNAEFTKLYTPKNFTRCSNQSDLVT--------------VHFDSILKQYVLHVDEEVLHKLSQS 115
            |.:.::..:|.| .|.:......||.              :..|.|||  .|::||..:.|.:.:
 Worm    35 PTSIQYVGVYQP-IFGKLEENGSLVVKGDLWDRCDLPDYEIWNDDILK--YLNMDETPITKCNIA 96

  Fly   116 KSNKFACFYQNITY---------GQSADHYD-------RMGKKTKFTHDY---VVPLNVQGMLVE 161
            ..         :||         ..||. ||       |...:|.|..::   ..|::.:.:...
 Worm    97 PP---------LTYLINGSWNAVNASAG-YDCKTRCHWRKDDRTNFIGNWNSTPGPVDCEFLEAI 151

  Fly   162 CRSGDEKRILQEDAFSFVQYQ-----KTSPNLDIDR----KASVIMYGIDTVSRTNLRRLMPVVF 217
            |...:.|      .:.::..|     ..:|.:|:.:    ..:||:  :|:::.....|.:|...
 Worm   152 CLKDNLK------VYGYMHSQIIPTPPITPKVDVSKLQQYDVTVIL--LDSLAHAQALRSLPRAI 208

  Fly   218 GFLKSPGWYEMMGY-NKVADNTYPNIFSILTGYSPNSAKNQICD--------TTQPGC---LDKI 270
            .::.|.....:..| |||.:|:..|...:..|.|.......:.|        |.:..|   .|..
 Worm   209 SYMTSHMSAVVFPYVNKVGENSRSNGVPLWFGKSLEKLDKSLFDEEDVTVDWTHEYMCNEFKDNE 273

  Fly   271 PFIWKDMKKNGYLTAYAEDTV-----FSNIFNYMKPGFLSRPTDYYFRPLLDALEKE------TI 324
            ..|:.:.:..||.|..|||..     |.|.     .||.:.|.|:|.||..:|||:.      |.
 Worm   274 TSIFNEFRDYGYKTLLAEDWAEGTLNFPNC-----KGFDNPPIDHYMRPFQNALERPHHGEFITR 333

  Fly   325 KLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVG 389
            ....||     .|.|...|: :.:|..:||..|..::. :.:.|::|:.||..:..|...:    
 Worm   334 NHLSPG-----NLTREHHNT-LLEYLSKFMNAYPNEKK-FSWIWASHLGHDSMNGFSHADN---- 387

  Fly   390 DLLNF-----EK-DGSFEHTIMIFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFREKYPRY 448
            |..||     || |.||    :|...|||.|||...:|....||...|.:.|.:|...| |....
 Worm   388 DFYNFLVKHREKLDNSF----VILMGDHGPRFGANRKTVSGELEVHNPFLGISIPKALR-KTTEI 447

  Fly   449 VEALAQNQNRLSSNFDIYNTLKHIINIEGLVE--DTK---------WSY-----DCPQCQSLFYE 497
            :..:..|..:|.:::|...|:..|:..:....  ||:         :|:     |.|        
 Worm   448 LSLMKGNAKKLQTHYDTRATILDILKYQSTTNFLDTEILKIPGEKGFSFIRKQPDTP-------- 504

  Fly   498 LPESRSCSEAAIPEAYCTC---HNYEEVQED--HGTWRMAELVVDRINQFLQYHNLQNLCSSLTL 557
                |:|....||..||.|   ...|.:..|  |.   ||:.:...:|..|:...||:.|..:..
 Worm   505 ----RNCKTMPIPIQYCLCKFNRTTESIHSDLAHS---MAKALTAAVNTELENGKLQSRCIKMEY 562

  Fly   558 KLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIY 622
            .::    :.:...||..   :|...|....::.:....:|...:....|.||:: :.:|.|:|.|
 Worm   563 SII----LSLDRLDEKF---RGSILYTIVVEMKKPSNAWFKANIKMLSTGELKV-LGIIERVNEY 619

  Fly   623 RPDASCLDDNIQKLFCICLSKL 644
            ...|.|:.....:.:|.|.:::
 Worm   620 GQTAHCIKSEYHRPYCFCRNQI 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
Y73F8A.35NP_001255870.1 DUF229 89..557 CDD:281053 117/522 (22%)
ALP_like 185..475 CDD:293745 80/313 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50151
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.