DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32984 and Y41E3.1

Sequence 1:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001041024.1 Gene:Y41E3.1 WormBaseID:WBGene00012762 Length:682 Species:Caenorhabditis elegans

Alignment Length:721 Identity:182/722 (25%)
Similarity:297/722 (41%) Gaps:149/722 (21%)


  Fly    18 LCIFILFLLIVWKITSYGVNDVLTIKY-------------------------------NENQKRF 51
            ||:.:.|:|...:|   |.:||..::.                               :|.....
 Worm    17 LCVSVYFVLSTLRI---GYDDVSRLEQSRAERYQEIDEIPVKVRTVHSDRDRHKGEDSSEKHAET 78

  Fly    52 YVNSSNCQMAYVEPFNAE---FTKLYTPKNFTRCSNQSDLVTVHFDSILKQYVLHVDEEVLHKLS 113
            .:.|..|.:..:|...:|   |.|.:.|   ..|..:        :||...:|. :::|.:.:.:
 Worm    79 ALQSQKCNIPKLEINGSEVINFFKTHAP---LECQKK--------NSIEDNWVF-INDEAIIRFT 131

  Fly   114 QSKSNKFACFYQNITYGQSADHYDRMGKKTKFTHDYVVPLNVQGMLVECRSGDEKRILQEDAFSF 178
            :.:: |..|   .|.|....|  |...|       |..|       ||...||..........|.
 Worm   132 EKRA-KAKC---KIQYFSRVD--DNNNK-------YEEP-------VEVLDGDRMNGSDYATISC 176

  Fly   179 VQ-YQK---------TSPNL------------DIDRKA-SVIMYGIDTVSRTNLRRLMPVVFGFL 220
            :| :||         ..|.:            |.::|. :|...|.|::|:.:.||.:|....||
 Worm   177 IQGFQKWKSILWDVNDEPEIHERARKMRKEQADPEKKPYNVYFLGFDSLSQMSFRRKLPQTVKFL 241

  Fly   221 KSP-GWYEMMGYNKVADNTYPNIFSILTGYS----PNSAK-----NQICDTTQPGCLDKIPFIWK 275
            :.. |...:.|||.|.|.|......|||..:    |.:.|     |.:.|.        .|||||
 Worm   242 EETLGSVVLNGYNIVGDGTPQAFIPILTAQTETELPLTRKRYKNANYVDDV--------YPFIWK 298

  Fly   276 DMKKNGYLTAYAEDTVFSNIFNYMKPGFLSRPTDYYFRPLLDALEKETIKLYCPGCKMVYCLGRR 340
            :....||:|.||||......|.|...||..:|||:|.|.|.:.:||...:         .|:|..
 Worm   299 NYSDKGYVTMYAEDAFSIGTFTYRLKGFRQQPTDHYTRTLFEEVEKLNDR---------NCIGSI 354

  Fly   341 LANSYIFDYCRQFMQRYVADRPIWGFFWSNHISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIM 405
            ..:.......||||::| .|.|.:.....:.:||||.:::......:...|.:...:|.|:.:::
 Worm   355 PLHRMWLQNGRQFMKKY-EDVPRFLLMHQSLLSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVV 418

  Fly   406 IFFSDHGSRFGPLMRTRESFLEERQPIMFIYLPPWFR--EKYPRYVEALAQNQNRLSSNFDIYNT 468
            |..:|||.||..|..|.:..||||.|...|.||...|  ||..:..:.|.:|..:|:|.|||:.:
 Worm   419 IVMADHGHRFAKLRDTHQGQLEERMPFFSISLPKQLRNTEKGRKMEQNLRENAEKLTSPFDIHAS 483

  Fly   469 LKHIINIEGLVE-DTKWSYDCPQCQSL--FYELPESRSCSEAAIPEAYCTCHNYEEVQ---EDHG 527
            |..|:|:..|.| :.....|....:||  |..:|..|:||:|.|...:|||.::::..   ||..
 Worm   484 LMDILNLSELGENELNRMQDASSKRSLSVFKPIPVDRTCSQAGIEPHWCTCLSWKDAMDTGEDRK 548

  Fly   528 -TWRMAELVVDRINQFLQYHNLQNLCSSLTL-KLVNITEV----------RITESDEHV-----S 575
             |.|:|..||..||:.:...  ::||:.|:| |:::..::          .:.::|..|     |
 Worm   549 LTRRIANAVVREINKEIVAE--KDLCAPLSLAKIIDAKKLLPDKGLLAYKNVKDADGFVPDLSGS 611

  Fly   576 LGKGLRHYHTKFQVHQNLAEFFATVLYDRKTEELQINVELISRINIYRPDASCLDDNIQKL--FC 638
            ......||..|.|.....|.:..|:.||...:|::::...:|.:|.:.....|:.|....|  ||
 Worm   612 TKAAFAHYQLKLQTTPGEAIYEVTLFYDIVRDEVKLDFGSMSHVNKFGDTPHCIIDKNYYLATFC 676

  Fly   639 ICLSKL 644
            :|..::
 Worm   677 VCYDRV 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32984NP_788014.2 None
Y41E3.1NP_001041024.1 DUF229 78..581 CDD:281053 153/555 (28%)
ALP_like 215..491 CDD:293745 92/294 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.