DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG9988

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster

Alignment Length:658 Identity:221/659 (34%)
Similarity:333/659 (51%) Gaps:92/659 (14%)


  Fly    25 RNSQFNQVQHEHYIKTSECHIPYINKPLENEKGNIKKQH-TICSKDESLINLRFDEKSHQYLLYV 88
            ||.| :.|:..:::::::|.|||::....:.......:| ..||.:.:|:...:|....:|:|::
  Fly    56 RNVQ-DVVRPAYFVESAKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFI 119

  Fly    89 NDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDYIVDAPVVYVCYLTDRSLKFEDQFLYSLGE 153
            |:.:|.:.|.|      |...|||.|:|:.|                  ||.....|:.     |
  Fly   120 NESLASIILNS------NGGEYNCYYQEITR------------------DRKHDSYDKM-----E 155

  Fly   154 EVKFWNGYIVPPSVEGMRATCR---NELAEDLQSDTFVLVQ--PPKTYAPLISWHRIPNVLLIGF 213
            ...|...|.||..|||:..||.   || ::.||||.:.|:|  ||.....|....|.|:||:.|.
  Fly   156 RKYFSQNYEVPLHVEGLILTCHRLGNE-SDILQSDAYNLIQYRPPPKGLSLKPSKRKPSVLMFGI 219

  Fly   214 DGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHTLMNLKCDSSVIGC 278
            |.:|:||.||..|.|:..|....||...||..||:||..||:|.||||:|.:.:...|:....||
  Fly   220 DSLSRINLRRTMPKVYKFLTRDGWFEQQGYNKIGDNTFPNLLAILTGYNPESAIKKVCNWHEDGC 284

  Fly   279 LKTVPLIWKHFKKKGFITAYGE---GISNLFDSEKYGIFEGTIDFYAR--HKNLQS--------- 329
            |...|.||.:|:...::|||.|   || |.|:..|.|..|...|||.|  .|.::|         
  Fly   285 LDRTPFIWHYFRNASYLTAYAEDEAGI-NTFNYWKPGFLEQPTDFYLRPLQKAIESGLNTWKCSD 348

  Fly   330 -----CIDRRFNIKHNYDYCEEFLKRHANTNRPFFGVFFGNGITNRSYD-NARIQTELLDKVKKF 388
                 ||.||....:.||....|..|..: .||.:|:|:.|..::.|:. .::::..:|..:..|
  Fly   349 CSMKYCIGRRITSSYAYDMARNFANRFVD-ERPIWGLFWSNSFSHDSFQMPSKMEDYVLQYLLDF 412

  Fly   389 KKMGILTQSIVV-----------LFSYPVSSVKEKKTNFSQEDLPILYIWLPPWFKAFRPEIVQA 442
            :..|:..|||:|           |.|.|        :.|.:|.||.::|:|||||:|..||..:|
  Fly   413 EADGVFDQSIMVFLSDHGSRYGRLMSLP--------SGFLEERLPSMFIYLPPWFRAQYPEYARA 469

  Fly   443 LRINSKRLTSPYDLHLTLQHLLELGERWP--RAVDKLVDCPTCQTLFAPVPENRTCSDAGIGESQ 505
            |.:|..||||.||||.||:|::|||.. |  :.:.|..|||.||:||.||.|.|:|.||||.|..
  Fly   470 LELNRNRLTSNYDLHNTLKHIIELGGT-PDGQTLPKAADCPKCQSLFYPVDETRSCEDAGIPEHF 533

  Fly   506 CPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLK-----SVKMVLQRK---DR 562
            |.|..||.|.:...|  |:..:::..|||:|...||.::|..|||.     .:|:.|.:.   |.
  Fly   534 CTCVPYKRLDTQWAK--SIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKVELDQNFHDDV 596

  Fly   563 KLSSGSTYRAYFSANPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCI 627
            ..:...|||..|....|:|:|..|:.:.|....:| :.|.:|:||::|:|.|:|::....:.:||
  Fly   597 PRAELGTYRTMFKVKQNSADFRATVIFNNVTDSVE-VEVPTISRLDSYENVSTCVKDKTDKMYCI 660

  Fly   628 CKSQILEN 635
            ||..|.::
  Fly   661 CKCDIKDD 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 186/531 (35%)
ALP_like 206..466 CDD:293745 106/291 (36%)
CG9988NP_651625.1 DUF229 90..580 CDD:281053 187/533 (35%)
ALP_like 212..493 CDD:293745 106/291 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915028
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.