DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG14731

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster

Alignment Length:653 Identity:153/654 (23%)
Similarity:256/654 (39%) Gaps:123/654 (19%)


  Fly    58 NIKKQHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSP----------------- 105
            |.::|.....|::..|..:.|.|    :|:||.  :|.::.||...||                 
  Fly    29 NFREQVEHKMKEQPPIEGKPDNK----MLFVNS--SQCQINSMDPFSPTAMYHMTPMPSSACPMI 87

  Fly   106 ------NLIGYNCSY-----REL-KRLNRDYIVDAPVVYVCYLTDRSLKFED---------QFLY 149
                  ::.|.|..|     :|| |:|....:.|   ::..|  .|.::|.|         .|.:
  Fly    88 KLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSD---IFCAY--KRFVRFNDFVNIYFESTLFRF 147

  Fly   150 S-LGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTFVLV-----QPPKTYAPLISWHRIPNV 208
            | |....|..:|.|.      :|..|..:....:..|.|:.:     |.....||:   .|: :|
  Fly   148 SKLRNFTKVDSGNIT------LRVWCWMDYGRLVYHDVFIFLPFPNPQKVNNSAPV---KRL-SV 202

  Fly   209 LLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHTLMNLKCDS 273
            |::|.|.||.::::|.|..|.:.::......:.||..:|:|:..||:..|:|.|   :..::..|
  Fly   203 LILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQS---VDEVEAKS 264

  Fly   274 SVIGC-----LKTVPLIWKHFKKKGFITAYGEG--ISNLFDSEKYGIFEGTIDFYAR----HKNL 327
            ...|.     .....|:|..|:..|:.|.:||.  ::..|...:.|..:...|||.|    ..::
  Fly   265 GCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHM 329

  Fly   328 QS-----------CIDRRFNIKHN--YDYCEEFLKRHANT---NRPFFGVFFGN-GITNRSYDNA 375
            :|           |...|  :.|:  ||:....|. |...   :|.||..|:.. |:.:......
  Fly   330 RSTYFARGPLEIKCSGDR--VYHHVLYDFIYRLLP-HMQARMYDRGFFAFFWQTMGVHDYFQYGE 391

  Fly   376 RIQTELLDKVKKFKKMGILTQSIVVLFS---YPVSSVKEKKTNFSQEDLPILYIWLPPWFKAFRP 437
            |...|....::..|:..||.:::|::.|   .......:......:..|||:....|...:...|
  Fly   392 RADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFP 456

  Fly   438 EIVQALRINSKRLTSPYDLHLTLQHLLELGERWPRAVDKLVDCPTCQ-------TLFAPVPENRT 495
            .....|..|:.||.:.||||.||:.:::|    ....|:.:...|.:       :||.|:||.|:
  Fly   457 LAFANLEANAHRLVTTYDLHETLKDVVDL----ENLSDERILNRTLRLRNNHNVSLFLPIPEERS 517

  Fly   496 CSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRK 560
            |..|.|....|.||.|..:..|......:.|..|.:||..|..   :..|..|.|.:|:....||
  Fly   518 CFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAP---YPQCEQLELLNVEDAYLRK 579

  Fly   561 DRKLSSGSTYRAYFSANPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKF 625
            ..||:  .|........|.|..|..|: .:.|...|:    ..|.|.:.|::.|.|.|......:
  Fly   580 QHKLN--KTIIVRLVTQPGNGHFDATV-LSKNETSLQ----GPITRTDQYRHQSFCAREAPIEIY 637

  Fly   626 CIC 628
            |.|
  Fly   638 CYC 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 132/570 (23%)
ALP_like 206..466 CDD:293745 68/291 (23%)
CG14731NP_650130.1 DUF229 77..573 CDD:281053 120/524 (23%)
ALP_like 200..485 CDD:293745 68/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49411
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.