DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG9168

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_612106.2 Gene:CG9168 FlyBaseID:FBgn0035216 Length:648 Species:Drosophila melanogaster

Alignment Length:703 Identity:202/704 (29%)
Similarity:328/704 (47%) Gaps:132/704 (19%)


  Fly     1 MKTSKTLIFIIAI-FLISHLSLSKKRNSQFNQVQHEHYIKTSECHIPYINKPLENEKGNI----- 59
            |...:.:..:.:| ||:....||          .|.||        |.:.|.|||:|..:     
  Fly     1 MSLGRNVFLLCSIQFLLCKAKLS----------LHSHY--------PNVAKTLENKKFYVDSPSC 47

  Fly    60 -----------------KKQHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNL 107
                             ::|...||.|:.|:...||....||.:.::::.||..|    ||..|.
  Fly    48 KMPEMDPFSADIMRFFKRRQFRECSSDKDLLISEFDSHLRQYRIKIDENSAQQHL----KKFGNA 108

  Fly   108 IGYNCSYRELKRLNRDYIVDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRA 172
            . ..|.|:.:.|..:|...|                 :.|.:|..:.:.  ..::||.:::.:..
  Fly   109 T-LKCEYQVIGRNKKDSFPD-----------------NHFSFSKLQPLS--QSFLVPKTIDFIST 153

  Fly   173 TCR----NELAEDLQSDTFVLVQPPKTYAPLISWHR------IPNVLLIGFDGISQINFRRNFPL 227
            .|.    |...:.||.|.|:.||....:....:.|.      .|||:::|.|..|::|.||:.|.
  Fly   154 QCHAVHGNIDLKLLQKDAFLFVQDRLNHEHKNTEHHRPDLQSKPNVIILGIDSTSRMNLRRSMPK 218

  Fly   228 VFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYS-PHTLMNLKCDSSVIGCLKTVPLIWKHFKK 291
            |...|:...||.|.||..:||||..||:|.|||.: .:.|.|.:...|  |.:..:..||:.|||
  Fly   219 VHKFLQRPGWFEMQGYNKVGENTLPNLLAILTGNAEENALFNGRFGHS--GFIDKLKFIWQLFKK 281

  Fly   292 KGFITAYGEGIS--NLFDSEKYGIFEGTIDFYARH---------KNLQS-----CIDRRFNIKHN 340
            .|::||:||..:  |.|:.:|.|..:..:|||.|:         |..:.     |:.|:...::.
  Fly   282 NGYMTAFGEDCAKINTFNYQKPGFKQQPVDFYLRNFIVALETILKTRREFGNVFCLGRKLGFQYV 346

  Fly   341 YDYCEEFLKRHANTNRPFFGVFFGNGITNRSYDNA-RIQTELLDKVKKFKKMGILTQSIVVLFS- 403
            :|:..:|::|..| :.|.||:|:.|..|:..:..| .:....|:.:..:.::|...:|||::.| 
  Fly   347 FDFARQFMQRFEN-SAPVFGIFWSNSFTHEDFLGATALDHVFLEYLTLYDELGFFNRSIVMVLSD 410

  Fly   404 ----YPVSSVKEKKTNFSQEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLL 464
                |.|:. :..|:.:.:|.||:::|.:||||:...|:.|:.|:||..||:|.:|||:||.|||
  Fly   411 HGYRYGVTR-QASKSGYLEERLPLMFIHVPPWFRKIYPQYVENLKINQNRLSSGFDLHMTLHHLL 474

  Fly   465 ELGERWPRAVDKLVD---------CPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMK 520
            .|.      ...:.|         |..||:||..:|.||.||.|||.|..|.|:..:.: :||..
  Fly   475 HLN------ATSMADFSPKLQASQCKMCQSLFFQLPANRNCSHAGIREKWCSCEPTETV-TNQRL 532

  Fly   521 QLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRKDRKLSSGS---------TYRAYFSA 576
            ...|.:::|..:|..|...||..||.|..||.|..:    |.|:|...         ||...|..
  Fly   533 LRKVAQEVVHHMNRHLRDRNLTTLCQNYALKKVLYL----DSKISLSEDSVEDEQLHTYIITFET 593

  Fly   577 NPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCICK 629
            ||::|.|..|::: |:.:|...:||:.::||.:|:..|.|.|....:|:||||
  Fly   594 NPSSAHFEATVQW-NSEKETLNMNVDELSRLESYEKHSKCTRDPIIKKYCICK 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 160/530 (30%)
ALP_like 206..466 CDD:293745 96/283 (34%)
CG9168NP_612106.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915053
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.