DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG18088

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster

Alignment Length:682 Identity:226/683 (33%)
Similarity:352/683 (52%) Gaps:102/683 (15%)


  Fly    11 IAIFLISHLSLSKKRN-------SQFNQVQ-----HEHYIKTSECHIPYINKPLENEKGNIKKQH 63
            |.:|||...:.|...|       ::|::|.     .:.::|||:|||||:: |..:|...:.|..
  Fly    23 IVLFLIYSSNTSSNTNHDLYPPTTRFSRVSVKAEPQKFFVKTSKCHIPYVD-PFNDEAMELYKPQ 86

  Fly    64 TI--CSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDY-- 124
            |:  ||.:..||:..::|...:::|:::|.||| ||.:...|.     |||.|||:|     |  
  Fly    87 TLITCSNETDLISTTYNEIIKRHILHIDDEVAQ-KLLNFTDKD-----YNCFYREIK-----YGK 140

  Fly   125 IVDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAED----LQSD 185
            |.|.      |...::.|:             |.:||.||..||||...|  :.|:|    ||.|
  Fly   141 IADT------YDNLKAKKY-------------FTSGYEVPVHVEGMIVEC--QTADDPIVVLQKD 184

  Fly   186 TFVLVQ----PPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGI 246
            .|..:|    |..:..|..:  |.|:|::.|.|.:|:||.||..|.|||.|:...|:.|.||..:
  Fly   185 AFAFIQHRPLPKDSIRPRAA--RKPSVIMYGIDSLSRINLRRTMPKVFNFLQGPGWYEMQGYNKV 247

  Fly   247 GENTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYG--EGISNLFDSE 309
            .:|:..|::|.|:|||..|.....||:...|||..:|:|||:||...::|.|.  |..||.|:..
  Fly   248 ADNSFPNILAILSGYSASTAKENVCDTDKQGCLDEMPMIWKYFKNASYLTGYAEDESNSNHFNYL 312

  Fly   310 KYGIFEGTIDFYAR-----------------HKNLQSCIDRRFNIKHNYDYCEEFLKRHANTNRP 357
            |.|..:..:|:|.|                 |..::.|:.||...::.|||..:|.||..: :||
  Fly   313 KPGFSKKPMDYYFRPLLRALESEMDVYRLPEHDYMRYCLGRRIANRYIYDYGLQFTKRFVH-DRP 376

  Fly   358 FFGVFFGNGITNRSYDN----ARIQTELLDKVKKFKKMGILTQSIVVLFS---YPVSSVKEKKTN 415
            .:|:|:.|   :.|:|:    :.:|.::|..:......|...:.|::.|:   .....:...|..
  Fly   377 IWGMFWSN---HFSHDDPFMPSAMQEKVLGDLIDMHADGQFEEMIMIFFADHGTRFGDLTYLKEG 438

  Fly   416 FSQEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLELGERWP--RAVDKLV 478
            |.:|.||:::|:|||||:...|..|:||.:|..||:|.:|||.||:|::|:|.. |  |.:.|..
  Fly   439 FLEERLPMMFIYLPPWFRETYPSYVRALELNQHRLSSNFDLHNTLKHIIEIGGT-PDGRELPKSF 502

  Fly   479 DCPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHNLHE 543
            ||||||:||.|:||.||||:|||.|..|.|:.||:: |.|.....:...::..:||:....||..
  Fly   503 DCPTCQSLFYPLPEGRTCSEAGIEEHWCTCEPYKII-SGQDWTTPIAHSVIDRMNEYFVQKNLTS 566

  Fly   544 LCHNLTLKSVKMVLQRKDRKL--------SSGSTYRAYFSANPNNAEFSTTIRYANNRQELEYIN 600
            ||.||||..|.....:....:        |..:.||..|....|:|:|..|:.|.|:.|..: :|
  Fly   567 LCSNLTLNYVHKTEIKTGLNIDWHQTLMESETAVYRIKFKVKQNSADFQATVVYHNSTQNAQ-VN 630

  Fly   601 VESINRLNNYQNDSSCMRRLRGRKFCICKSQI 632
            ||.|:|.|:|:.||:|:.....:.:|||.|.:
  Fly   631 VEKISRTNSYKEDSTCIDDKLAKLYCICFSDL 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 181/526 (34%)
ALP_like 206..466 CDD:293745 96/286 (34%)
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 183/533 (34%)
ALP_like 207..489 CDD:293745 96/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915061
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.