DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG3123

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster

Alignment Length:692 Identity:143/693 (21%)
Similarity:271/693 (39%) Gaps:142/693 (20%)


  Fly     8 IFIIAIFLISHLSLSKKRNSQFN-----QV----QHEHYIKTSECHIPYINKPLENEKGNIKK-- 61
            ||::|:.....|:....||...:     |:    :.|.::.|:.|.|. ..|||.....:..:  
  Fly    13 IFLLAVLCYLILTSLSDRNKTISIREVPQIYINEEDELFVNTTGCRIS-ATKPLSLYALSFMEPI 76

  Fly    62 QHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDYIV 126
            :..:|..::.::.....:::     |:..::::..:.|.::.|       |.|||..|::     
  Fly    77 EPVLCRMEQLMVAETIGDRN-----YLVRNISRHGILSWRQVS-------CIYREFVRVD----- 124

  Fly   127 DAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTFVLVQ 191
            ||...|:      ||||     :.|.:..::..   |...::.:|..|..:....:..|....:.
  Fly   125 DAHNKYI------SLKF-----FKLTDRTRYLE---VGTGLQHIRTWCWVDFGRIIFHDVMYFLP 175

  Fly   192 PPKTYAPLISWH--RIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNL 254
            |........:.|  |..:|:::|.|.||.:::.|.|..|.:.::........||..:..||..||
  Fly   176 PLPQATNRSTEHQKRKLSVMILGVDSISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNL 240

  Fly   255 MASLTGYSP--------HTLMNL-KCDSSVIGCLKTVPLIWKHFKKKGFITAYGE--GISNLFDS 308
            :..::|.|.        |..:|. ||:           .:|..||:.|:.|.:.|  ..:.||..
  Fly   241 IPLVSGLSVSEMEASCYHDELNFDKCN-----------FLWNEFKRAGYSTIFAEDTDTAGLFIY 294

  Fly   309 EKYGIFEGTIDFYAR--------HKNLQS-----CIDRRFNIKHNYDYCEEFLKRHANTNRPFFG 360
            .|.|..:...|.|.|        |...::     |...|...:..||:..:.:   .:..|..|.
  Fly   295 RKRGFQKQPTDIYMRPLMTEIESHSLYRTTFDLKCTGHRLYGEFYYDFVSKLI---PHMERQLFF 356

  Fly   361 VFFGN--GITNRSYDNAR-IQTELLDKVKKFKKMGILTQSIVVLF-SYPVSSVKEKKTNFSQEDL 421
            .|..|  || :..:..|: :..:.|..:.:..:.|::..::::.. .:.:...|..:|...|.::
  Fly   357 SFLWNMHGI-HDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFMGDHGLRFDKFARTAPGQHEM 420

  Fly   422 --PILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLELGERWPRAVDKLVDCPTCQ 484
              |:|....|.|.|...|..:.....|::.|.:.:|||.||:.::.|        |:|.|.....
  Fly   421 SQPLLIAIYPEWLKRRFPLAMSNFERNARSLITTFDLHETLKDVIHL--------DRLTDANVRN 477

  Fly   485 -----------TLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNH 538
                       :||.|:|:||.|..|.|.:..|.|:..|.:|:::..........|..|||.:..
  Fly   478 RTLYLTNERGISLFLPIPQNRNCKTAEIKQHYCLCNELKSVSTHESAIQEAASFAVDRINELIKP 542

  Fly   539 HNLHELCHNLTLKSVKMVLQRKDRKLSSGSTYRAYF---------SANPNNAEFSTTIRYANNRQ 594
               :..|..|:|:||:...:.|      .||||..:         ...|.:..|..|:.      
  Fly   543 ---YPQCRVLSLQSVRTAYRAK------SSTYRGNYRVSQVMVRLKTTPGDGNFDATVL------ 592

  Fly   595 ELEYINVES--------INRLNNYQNDSSCMRRLRGRKFCIC 628
             :..:|.|.        :.|.:.|.:.:.|::..|...:|.|
  Fly   593 -ITMLNGEKTDMKLGGPVTRTDRYAHQAYCVQNYRIEMYCYC 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 113/531 (21%)
ALP_like 206..466 CDD:293745 63/290 (22%)
CG3123NP_608716.1 DUF229 74..555 CDD:281053 113/538 (21%)
ALP_like 192..468 CDD:293745 64/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49401
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.