DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG32985

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_788013.2 Gene:CG32985 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster

Alignment Length:681 Identity:214/682 (31%)
Similarity:355/682 (52%) Gaps:105/682 (15%)


  Fly     5 KTLIFIIAIFLISHLSLSKK--------RNSQFNQVQHEHYIKTSECHIPYINKPLENE--KGNI 59
            :.::..:|:.||...|::..        |:||  :|:...|:::.:|.:.|:| |...|  |.|.
  Fly    11 RLIVSFLAVTLICLWSMNSSRVDENFSARDSQ--EVEKLFYVESGKCKMRYVN-PFNAEFLKINH 72

  Fly    60 KKQHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDY 124
            .|....|:.:..||::.:|:..:||:|:.|:.|    |..:.:...|  .:.|.|::        
  Fly    73 PKAFIPCTNESDLISVHYDKILNQYVLHTNEEV----LHELSESKTN--DFACFYQK-------- 123

  Fly   125 IVDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAED---LQSDT 186
                 ::|     .:|.:..|    ..|.:.|....::||..||||...||.  |::   ||.|.
  Fly   124 -----IIY-----GQSAEHYD----GKGVKTKISQNHLVPLDVEGMLVECRT--ADEMRVLQRDA 172

  Fly   187 FVLVQ---PPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGE 248
            ||.||   ||:...|:    :..:|::.|.|.:|:.|.||..|:||..||...|:.|.||..:.:
  Fly   173 FVFVQYKDPPQNVKPV----KKASVIMYGIDTVSRTNLRRMMPMVFEFLKSPGWYEMMGYNKVAD 233

  Fly   249 NTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEG--ISNLFDSEKY 311
            |:..|:.|.|||:||.:.....|::.|.|||..:|.|||.|||.|::|||.|.  .||.|:..|.
  Fly   234 NSFPNIFAMLTGFSPESAETQICNTDVDGCLDKIPFIWKDFKKDGYLTAYAEDEEHSNTFNYAKP 298

  Fly   312 GIFEGTIDFYARH-----KN-----------LQSCIDRRFNIKHNYDYCEEFLKRHANTNRPFFG 360
            |......|:|.|.     :|           ::.|:.||....:.:|||.:|::|.. .:||.:|
  Fly   299 GFAVKPTDYYFRPFLTALENETFIQYCPGCVMKYCLGRRLASSYIFDYCRQFMQRFV-ADRPIWG 362

  Fly   361 VFFGNGITNRSYDN----ARIQTELLDKVKKFKKMGILTQSIVVLFS------YPVSSVKEKKTN 415
            :|:.|   :.|:|:    :.:|.::|:.:..|:|.|:...:|::.||      .|:...||.   
  Fly   363 MFWTN---HYSHDDLFMLSAMQHKILEDLLSFEKDGVFEHTIMIFFSDHGARFGPLMYTKEA--- 421

  Fly   416 FSQEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLEL-----GERWPRAVD 475
            |.:|.||:::|:|||||:...|..|:||..|..||:|.:||:.||:|::.:     ..:|.    
  Fly   422 FLEERLPMMFIYLPPWFRKKYPRYVEALAQNQNRLSSNFDLYNTLKHIINIEGLVEDTKWS---- 482

  Fly   476 KLVDCPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHN 540
              .|||.||:||.|:||:|:||:|.|.|:.|.|.:|:.:..:| ....:...:|..:|::|::||
  Fly   483 --YDCPQCQSLFYPLPESRSCSEAAIPEAYCTCHNYEEIKEDQ-GTWRLANLVVDRMNKYLHYHN 544

  Fly   541 LHELCHNLTLK---SVKMVLQRKDRKLSSGST-YRAYFSANPNNAEFSTTIRYANNRQELEYINV 601
            |..||.||||:   |.::.:..||..|::|.. |...|..:.|.|||..|:.|....:||: :||
  Fly   545 LQNLCSNLTLRVINSTEVRMDDKDVDLANGMRHYHTKFQVHQNLAEFFATVLYDKQTEELQ-MNV 608

  Fly   602 ESINRLNNYQNDSSCMRRLRGRKFCICKSQI 632
            |.|:|.|.|..||.|:.....:.:|:|.|::
  Fly   609 ELISRTNMYGTDSECVNNKIQKLYCVCLSKL 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 170/530 (32%)
ALP_like 206..466 CDD:293745 99/288 (34%)
CG32985NP_788013.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4915020
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.