| Sequence 1: | NP_609260.1 | Gene: | CG9525 / 34217 | FlyBaseID: | FBgn0032080 | Length: | 678 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_788013.2 | Gene: | CG32985 / 326244 | FlyBaseID: | FBgn0052985 | Length: | 644 | Species: | Drosophila melanogaster | 
| Alignment Length: | 679 | Identity: | 213/679 - (31%) | 
|---|---|---|---|
| Similarity: | 355/679 - (52%) | Gaps: | 101/679 - (14%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     5 KTLIFIIAIFLISHLSLSKKR-NSQFN-----QVQHEHYIKTSECHIPYINKPLENE--KGNIKK 61 
  Fly    62 QHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDYIV 126 
  Fly   127 DAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAED---LQSDTFV 188 
  Fly   189 LVQ---PPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENT 250 
  Fly   251 QSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEG--ISNLFDSEKYGI 313 
  Fly   314 FEGTIDFYARH-----KN-----------LQSCIDRRFNIKHNYDYCEEFLKRHANTNRPFFGVF 362 
  Fly   363 FGNGITNRSYDN----ARIQTELLDKVKKFKKMGILTQSIVVLFS------YPVSSVKEKKTNFS 417 
  Fly   418 QEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLEL-----GERWPRAVDKL 477 
  Fly   478 VDCPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHNLH 542 
  Fly   543 ELCHNLTLK---SVKMVLQRKDRKLSSGST-YRAYFSANPNNAEFSTTIRYANNRQELEYINVES 603 
  Fly   604 INRLNNYQNDSSCMRRLRGRKFCICKSQI 632  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG9525 | NP_609260.1 | DUF229 | 66..554 | CDD:281053 | 170/529 (32%) | 
| ALP_like | 206..466 | CDD:293745 | 99/287 (34%) | ||
| CG32985 | NP_788013.2 | DUF229 | 72..554 | CDD:308570 | 168/529 (32%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45469438 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D31599at6960 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005924 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR10974 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 4.040 | |||||