DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and CG31933

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster

Alignment Length:563 Identity:133/564 (24%)
Similarity:211/564 (37%) Gaps:136/564 (24%)


  Fly   163 VPPSVEGMRATCRNELA-EDLQSDTFVLVQPP------KTYAPLISWH--------RIP-NVLLI 211
            ||..:..||..|.|... :.|..|....:|||      |..|.|..|.        ..| :|:::
  Fly   148 VPKGLRHMRVKCLNTFTNKTLHDDAHFFIQPPPEKLLKKPPATLKYWDGEKHSSGATSPISVMIL 212

  Fly   212 GFDGISQINFRRNFPLVF-----NQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHTLMNLKC 271
            |.|.:|.:|..|..|...     |..:::.|    |:..||.||..||:|.|||.|       ..
  Fly   213 GLDSVSHLNLLRQMPRTVRYMRQNMSQVEFW----GFNKIGTNTYPNLIALLTGLS-------AA 266

  Fly   272 DSSVI----GCLKTVPLIWKHFKKKGFITAYGE--GISNLFDSEKYGIFEGT---------IDFY 321
            :|...    .|:..:|||||.||:.|:.|::.|  .|.::|...|.|....|         :|.|
  Fly   267 ESEAYWVRQKCMDNLPLIWKEFKRAGYNTSFAEDMAIYSMFYFGKPGFKRPTTDNNLHDFMVDLY 331

  Fly   322 ARHKNLQS-------CIDRRFNIKHNYDYCEEFLKRHANTNR-PFFGVF-FGNGITNRSYDNARI 377
            .   |.|:       |:..|..:....:..:..|   .:|.| |||..: :.||. :..:::.|:
  Fly   332 I---NRQASSVSDTHCMGERAFMDILLEMNDRLL---PHTQRYPFFSFYWWANGF-HEFFNSPRL 389

  Fly   378 QTELLDK-VKKFKKMGILTQSIVVLFSYPVSSVKEKKTNFS---QEDLPILYIWLPPWFKAFRPE 438
            .....:: ::.....||...:|:...|.........:::|.   ::..|.|.:..|.|.:...|.
  Fly   390 ADGRFERLLRSLDDAGITNNTIIFFMSDHGLRWGLFRSSFQGMIEDSQPFLSVLYPKWMRLKYPM 454

  Fly   439 IVQALRINSKRLTSPYDLHLTLQHLLE-------------------LGERWPRAVDKLVDCPTCQ 484
            .:::|..|:..|.:.||||.||:|:||                   .|.:.||||          
  Fly   455 AIKSLVGNAHSLVTTYDLHETLKHILEPSSLEDTSITQKTEELWKLKGSQTPRAV---------- 509

  Fly   485 TLFAPVPENRTCSDAGIGESQCPC-DSYKLLSSNQM--KQLSVGKQIVRSINEFLNHHNLHELCH 546
            :||.|:|..|.|:.:.|....|.| ....:..||::  |..|:   |:..:|:.:..   :.:|.
  Fly   510 SLFLPIPPWRNCNTSHIPSKFCLCHKQIPIPESNRVVTKSASI---IIDYVNQLMVE---YPVCI 568

  Fly   547 NLTLKSVKMVL----QRKDRKLSSGSTYRAY--------------------FSANPNNAEFSTTI 587
            .|.|.|::...    ||.|...........|                    ....|.||.|....
  Fly   569 PLQLDSIESAYFAAPQRDDDFYIEKGHKNVYPEKGPFWKKQKYEDRDIVVRLKTKPGNAYFEGMT 633

  Fly   588 RYANNRQEL--EYINVESINRLNNYQNDSSCMRRLRGRKFCIC 628
            |...::..|  |.:.|......||     .|:.......||.|
  Fly   634 RRQGSKLSLVGEVVRVGGEGNRNN-----DCIDNPLLEPFCHC 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 115/462 (25%)
ALP_like 206..466 CDD:293745 76/313 (24%)
CG31933NP_722734.1 DUF229 114..576 CDD:281053 115/462 (25%)
ALP_like 208..483 CDD:293745 75/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49426
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.