DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and T07G12.3

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans

Alignment Length:706 Identity:141/707 (20%)
Similarity:262/707 (37%) Gaps:172/707 (24%)


  Fly     1 MKTSKTLIFIIAIFLISHLSLSKKRNSQFNQVQHEH-YIKTSECHIPYINKPLENEKGNIKKQHT 64
            ||..|.:|.|:..||..::...:..|:...:::.:. |:.:|                  :..|.
 Worm     1 MKFIKYIITILLAFLGFYMLSWRSFNNGSTKIESKFLYLDSS------------------RSAHN 47

  Fly    65 ICSK------DESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLI--GYNCSYRELKRLN 121
            ||:.      |.|:.|:     .|:|....|.:...::...:...:..::  |.||..|      
 Worm    48 ICALPIYDYWDTSIKNV-----MHEYNPARNCYKNYVQWTELVNSTWRIVKDGANCLAR------ 101

  Fly   122 RDYIVDAPVVYVCYL---TDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQ 183
                        |:.   ..:::|        :|..:|  .|::   ..|.:...|..:..| :.
 Worm   102 ------------CFSGIGGSKNVK--------IGPWMK--PGHV---DCEFLETVCWEDNIE-VY 140

  Fly   184 SDTFVLVQPPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGY---TG 245
            ......:.|.|  |....:...|||.:...|.::....:|:||.:.:..|.:  |:|..:   ..
 Worm   141 GHIHTQIIPRK--ASPTKFKDAPNVFIFTIDAMNTGMAKRSFPKLLSYFKNE--FQMIEFPFVNK 201

  Fly   246 IGENTQSNLMASLTGYSPHTLMNLKCDSSVIG------C---LKTVPLIWKHFKKKGFIT-AYGE 300
            :|||::.|.:....|.|......:..|...:.      |   |.....|:|.||..|:.| .:.:
 Worm   202 VGENSRPNGLPLWFGKSIEGGRRVTGDDVEVDWDWNQYCETYLDNSSHIFKDFKDHGYATMLFED 266

  Fly   301 GISNLFD-----------------------SEKYGIFEGTIDFYARHKNLQSCIDRRFNIKHNYD 342
            ...|:.|                       ||.:|     ::...||.:.:.|       :..:.
 Worm   267 WEGNVVDSWPTCVGFEEPPTDHTFRPFASVSETHG-----MEITKRHLSGKFC-------RETHH 319

  Fly   343 YCEEFLKR--HANTNRPFFGVFFGNGITNRSYDNARIQTELLDKVKKFKKMGILTQSIVVLF--S 403
            ...|.|::  .|..:||.|...:...:.:...|.|....|.|  |..|||...:..:..|:|  .
 Worm   320 AIMELLEQGIEAYKDRPIFSWLWLAWVAHDWIDGAARVDEYL--VNYFKKHNNMFDNSFVMFVSD 382

  Fly   404 YPVSSVKEKKTNFS--QEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLEL 466
            :.:.:.|..:|...  :.|.|.|.|.:|..|:|.:..|::.|..:||:|.:.:|:..||..:|:.
 Worm   383 HGLRTGKHMRTEIGAFERDNPFLSISIPKRFRATKFGILETLNFDSKQLQTHFDVRATLLDILKF 447

  Fly   467 ---------------GERWPRAVDKLVDCP-TCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLS 515
                           .|:....:.|..|.| ||.||  |:|           :..|.|...|...
 Worm   448 QPTSKFMDRQQKNIPDEKGHSLIRKQPDFPRTCATL--PIP-----------QQWCICQVDKFEI 499

  Fly   516 SNQMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQ------RKDRKLSSGSTYRAYF 574
            .|:..:..:|::::..::..|...|:.|:|....|..|..:::      .:..|:|..:|..:| 
 Worm   500 HNETLKNHLGEKLLNHVHRKLKKLNVSEICETFRLSKVTSLIEYGYVRTMRTYKISVETTISSY- 563

  Fly   575 SANPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCICKS 630
                  |.|.|.:.|   ..|.:....|.:.||:||...:.|.:.:|....|.||:
 Worm   564 ------AHFETFVTY---DIETDIAKFEKVTRLDNYAMTTDCTKPIRQSPLCYCKN 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 110/557 (20%)
ALP_like 206..466 CDD:293745 67/302 (22%)
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 105/534 (20%)
ALP_like 161..448 CDD:293745 67/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.