DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and R03G8.1

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_510172.2 Gene:R03G8.1 WormBaseID:WBGene00010996 Length:663 Species:Caenorhabditis elegans

Alignment Length:682 Identity:134/683 (20%)
Similarity:240/683 (35%) Gaps:182/683 (27%)


  Fly    43 CHIP-----------YINKPLENEKGNIKKQHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLK 96
            |.:|           |:| |.||.   :||    |  |.|...|...|.|...:.:.::...:.:
 Worm    55 CELPRYDVWDEELFGYLN-PNENP---LKK----C--DTSFKPLTKLENSKWGVTFAHNLTCRAR 109

  Fly    97 LRSMKKKSPNLIG--------YNCSYRE---------------------------LKRLNRDYIV 126
            ..:.|:...||:|        .||...|                           |.|.|.|  :
 Worm   110 CHTRKRDKENLVGNWTYTPGKINCEILETVCAEKGGEQRDVYGYLHSQIIPTKPKLSRTNAD--L 172

  Fly   127 DAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTFVLVQ 191
            ....|:|..|.  ||.: .|...||...|.|:..|     ::|:.....|::.::.:        
 Worm   173 KEYDVFVILLD--SLSY-SQAARSLPRTVSFFKSY-----MKGIIFPYMNKVGDNSR-------- 221

  Fly   192 PPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQ-DWFRMDGYTGIGENTQSNLM 255
                          ||.:.:.|..:.:...|    .:|::..:: || ..|.:..:.::.:::|.
 Worm   222 --------------PNGVALWFGKLLEKVDR----FIFDKPSLEADW-TDDYFCNVFKDNETSLF 267

  Fly   256 ASLTGYSPHTLMNLKCDSSVIGCLKTVPLIW-----------KHFKKKGFITAYGEGISNLFDSE 309
            ..   :..|....|..:...:|     .|||           .|:.:. |..|:          |
 Worm   268 DE---FKTHGYKTLMAEDWALG-----TLIWPNCLGYRNQSIDHYMRP-FQLAH----------E 313

  Fly   310 KYGIFEGTIDFYARHKNLQSCIDRRFNIKHN--YDYCEEF------------LKRHANTNRP--- 357
            |||     ......|.|...|.:     .||  .||..:|            |||..:.|.|   
 Worm   314 KYG-----TPVTREHLNGSLCRE-----DHNTLLDYLAQFLDAYSGSNDSIQLKREKSPNSPDQR 368

  Fly   358 --------FFGVFFGNGI--TNRSYDNARIQTELLDKVKKFKKMGILTQSIVVLF---SYPVSSV 409
                    ..|....||.  |....||     :.|:...|.:|.  |..|.|:|.   .:.:..|
 Worm   369 KFAFLWTTRLGHATENGFDATENGSDN-----DFLNFFIKHRKK--LEDSFVLLLGDHGFRLGGV 426

  Fly   410 KEKKTNFSQEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLEL--GERWPR 472
            :.........:.|:..|.:|...:. ..:|::.|.:||::|.:.:|...|:..:|:.  .|::..
 Worm   427 RNTAVGAIDVNNPLTAISVPNSLRT-NTDILKILNMNSEKLQTHFDTRATILDILKFQPAEKFSA 490

  Fly   473 AVDKLVDCPTCQT-LFAPVPENRTCSDAGIGESQCPCDSYKL-LSSNQMKQLSVGKQIVRSINEF 535
            .....:.....|: |....|.||.|....|....|.|...|. :..|....:.:|:::..::|:.
 Worm   491 ITPLQIPGEKGQSHLRNQPPFNRNCQTMPIPFEYCICQFNKTSVPINSTISMEIGEKVAENVNKL 555

  Fly   536 LNHHNLHELCHNLTLKSVKMVLQRKDRKLSSGSTYRAYFS-ANPNNAEFSTTIRYANNRQELEYI 599
            |..:|....|.::..:..:.:|| .::||.:.:.|..... ..|:.|:|..|::......::   
 Worm   556 LQINNFTSECISMVFERTESLLQ-YNQKLGNSTIYTVIAQMKKPSEAKFKATVKITEGNIKI--- 616

  Fly   600 NVESINRLNNYQNDSSCMRRLRGRKFCICKSQ 631
             |..:.|:::|...:.|:.....|..|.||.|
 Worm   617 -VSKVERVDSYGKTADCIESETHRPICYCKEQ 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 107/569 (19%)
ALP_like 206..466 CDD:293745 60/302 (20%)
R03G8.1NP_510172.2 DUF229 74..651 CDD:281053 129/663 (19%)
ALP_like 175..483 CDD:293745 73/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50074
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.