DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and M03F8.5

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_504546.2 Gene:M03F8.5 WormBaseID:WBGene00019764 Length:417 Species:Caenorhabditis elegans

Alignment Length:474 Identity:93/475 (20%)
Similarity:168/475 (35%) Gaps:141/475 (30%)


  Fly     1 MKTSKTLIFIIAIFLI------------SHLSLSKKRNSQFNQVQHEH---YIKTSECHIPYINK 50
            |...:|:..:|.|.||            |||:.......:|......|   ::..:.|...:.: 
 Worm     1 MLRRRTISALIQIVLITSLICLFYIVSQSHLNFKPNLKLEFRNFSEPHRQAHLFDNYCKFAWTD- 64

  Fly    51 PLENEKGNIKK-----QHTICSKDESLINLRF---DEKSHQYLLYVN--DHVAQL---------- 95
            |:::   .:||     :|..|.|....:..|:   .|.|.:...|.|  :.|||:          
 Worm    65 PMDS---TLKKRLKFPKHASCEKYNIDLFKRYPATGEFSMKLKSYKNNLECVAQVLKGGLRPEAH 126

  Fly    96 --KLRSMKKKSPNLIGYNCSYRELKRLNRDYIVDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFW 158
              ||...:..||             :||:.:.::|....:...:.:.:.:..||: .|..:.|  
 Worm   127 TFKLGRTQNFSP-------------KLNKRFWINADNFLITCFSKQLVIYRKQFM-GLNMQEK-- 175

  Fly   159 NGYIVPPSVEGMRATCRNELAEDLQSDTFVLVQPPKTYAPLISWH-----RIPNVLLIGFDGISQ 218
                :|..|:|                :||:.:|..|:      |     |. ::.::|.|..|:
 Worm   176 ----LPLVVDG----------------SFVIPEPDYTF------HGEKSTRF-SISILGLDSTSR 213

  Fly   219 INFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHT-LMNLKCDSSVIGCLK-- 280
            ..|.||.......|........:.|..:|:|:..|::.........| .|:|..::..:...|  
 Worm   214 AQFGRNMKKTSGLLDRLGSVVFNAYNKVGDNSAVNMLPIFANELQETESMSLIDETGDVNINKIL 278

  Fly   281 ---------TVPLIWKHFKKKGFITAYGEGISN----LF----DSEKYGIFEGTIDFYAR--HKN 326
                     |:..|||....: :||.|.:.|.:    ||    |:...|..:....||.|  :.:
 Worm   279 PSKTPLNPDTIQWIWKQLPPE-YITMYNDDIMHTSRGLFHYPPDNFLGGFSKPPAKFYYRPYYNH 342

  Fly   327 L--------QSCIDRRFNIKHNYDYCEEFLKRHANTNR-----PFFGVFFGNGITNRSYDNARI- 377
            |        :.|:|.:.       ..|.|:.......|     |.||..|.:.:|:...:|..: 
 Worm   343 LYTQMNNWWRKCLDGQL-------LAEVFIDSWFRFERVFGKLPHFGFTFISSLTHDDPNNLNLL 400

  Fly   378 ------QTELLDKVKKFKK 390
                  :.|.|:.:  |||
 Worm   401 DNTLYHRLEYLNLI--FKK 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 77/390 (20%)
ALP_like 206..466 CDD:293745 47/228 (21%)
M03F8.5NP_504546.2 ALP_like 201..>391 CDD:304875 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49728
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.