DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and K03A11.4

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_510170.2 Gene:K03A11.4 WormBaseID:WBGene00010521 Length:664 Species:Caenorhabditis elegans

Alignment Length:665 Identity:132/666 (20%)
Similarity:242/666 (36%) Gaps:183/666 (27%)


  Fly    76 RFDEKSHQYLLYVNDHVAQLK--------LRSMKKKSPNLIGYN--------CSYRELKRLNRDY 124
            ::|....:.:.|||.:...||        ..:::..|..::..|        |..|:..|  |::
 Worm    83 KYDVWDEEVMPYVNPNKNPLKNCDTSFVPFTALQNSSWKIVNTNKNLECRARCHTRKSDR--RNH 145

  Fly   125 I---VDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVP-PSVEGMRATCRNELAEDLQSD 185
            |   :..|....|...:.:....:|.:|.      :.:..::| |.:|  :.|.  :::..:|.|
 Worm   146 IGEWMRTPGPVDCEFLEAACSENNQDVYG------YLHSQVIPKPPIE--KPTI--DISSLMQFD 200

  Fly   186 TFVLVQPPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWF--RMDG----YT 244
            .||::                      .|.:|....||..|      :...:|  .|||    |.
 Worm   201 VFVIL----------------------LDSLSYSQGRRALP------RTLSYFTNHMDGVIFPYV 237

  Fly   245 G-IGENTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEGISNLF-D 307
            . :|||::.|.:....|.|..     |.|.:::. .|.:|..|.|   |.|...|.:..::|| :
 Worm   238 NKVGENSRPNGIPIWFGKSLE-----KIDKTLLD-EKVIPPDWPH---KYFCKTYKDNETSLFSE 293

  Fly   308 SEKYGI--------FEGTIDF---------------------YARHKNLQSCIDRRFNIK----- 338
            ...||.        .:||:::                     |.|..:..|...:..|.|     
 Worm   294 FHDYGYRTLLAEDWADGTMNWPNCVGFENPPIDHFMRPFQNAYERKNHGTSLTQKHLNGKLCRET 358

  Fly   339 HN--YDYCEEFLKRHANTNRPFFG----VFFGNGITN------RSYDNARIQTELLDKVKKFKKM 391
            |:  .||..:|.|.:.:..:  ||    :..|:...|      :.:.|..|         |.:| 
 Worm   359 HHTLLDYMGQFTKAYPDQRK--FGWVWAIDLGHNTENGFAHADKDFHNYLI---------KHRK- 411

  Fly   392 GILTQSIV-VLFSYPVSSVKEKKTNFSQEDL--PILYIWLPPWFKAFR--PEIVQALRINSKRLT 451
             .|.:|.| :|..:.:.....:||.....|:  |...:.:|   |..|  .:|::.:..|:|::.
 Worm   412 -ALDESFVFILGDHGLRFGDVRKTFVGSLDVNNPFTALSIP---KVLRKTTKILEIMTENAKQIQ 472

  Fly   452 SPYDLHLTLQHLLEL---------------GERWPRAVDKLVDCPTCQTLFAPVPENRTCSDAGI 501
            |.||...|:..:::.               ||:....:.|....|            |.|.:..:
 Worm   473 SHYDTRATILDIMKYQSANSFSETMPREIPGEKGSSYIRKQPSTP------------RNCRNMPV 525

  Fly   502 GESQCPCDSYK-LLSSNQMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRKDRKLS 565
            ....|.|...| .|..|.....|:||.:..::|..:...|..::|..:..:....:|...|:  .
 Worm   526 PLQYCICQFKKSKLPRNTTTAESIGKALATAVNTQIAEANFTKMCIKMEWEKTTSLLAYDDK--F 588

  Fly   566 SGSTYRAYFSA--NPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCIC 628
            .|:|..:..:.  .|:||||...::..|.  |::.:.:  :.|.|.|...:.||:....|.:|.|
 Worm   589 KGATLYSVTAVMKEPSNAEFKGNVKIMNG--EIKVLGM--VERSNKYGKTADCMKSEHHRPYCYC 649

  Fly   629 KSQILENHSTSEVTK 643
            ..|   |....:.||
 Worm   650 ADQ---NSDGKKKTK 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 109/573 (19%)
ALP_like 206..466 CDD:293745 67/319 (21%)
K03A11.4NP_510170.2 DUF229 98..570 CDD:281053 104/549 (19%)
ALP_like 199..488 CDD:293745 70/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.