DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and F32D8.2

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_505771.2 Gene:F32D8.2 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans

Alignment Length:615 Identity:115/616 (19%)
Similarity:206/616 (33%) Gaps:200/616 (32%)


  Fly     7 LIFIIAIF--LISHLSLSKKRNSQFNQVQHE----------HYIKTSECHIPYINKPLENE---- 55
            |.|.:.||  ::||.|:..|...:...::::          ..:.|:.|.:|||..|.|:|    
 Worm    21 LCFFLLIFSVIMSHFSIEIKEFDKDGGIKYKPEFVYSLVETRELLTNVCKLPYIFFPNEDEDVFG 85

  Fly    56 -KGNIKKQHTI---CSKDESLINLRFDEKSHQYLLY----VNDHVAQLKLRSMKKKSPNLIGYNC 112
             ..:..|||.:   |..:|  :|.:.|..|..||..    .||..:.::....|...||      
 Worm    86 LTPDKSKQHIVRGECKINE--LNEKVDLSSDGYLTLRSKNTNDLPSDIRCTFYKNSGPN------ 142

  Fly   113 SYRELKRLNRDYIVDAPVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATC-RN 176
                                     :..:|.|.    ::..:|.|:|          ....| ||
 Worm   143 -------------------------EHPIKVEK----NVPVKVPFYN----------FAFACERN 168

  Fly   177 ELAEDLQSDTFVLVQPPKTYAPLISWHRIP------NVLLIGFDGISQINFRRNFPLVFNQLKMQ 235
            .:.|.|:              |.:::..||      ::.:|....|:...|.:..||  ::..||
 Worm   169 GIVEFLK--------------PFVNFASIPKKSNGGSIAIIFLPAINHKLFMKKMPL--SKHFMQ 217

  Fly   236 D-WFRMDGYTGIGE-NTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAY 298
            | .||...:....| |:..:|:..|                                        
 Worm   218 DNQFRFAQFMSKNEPNSMQDLLLQL---------------------------------------- 242

  Fly   299 GEGIS---NLFDSEKYGIFEGTIDFYARHKNLQSCIDRRFNIKHNYDYCEEFL----------KR 350
              |||   |:|...|...|   ..|::..:.::..||..::...:.::..:||          |:
 Worm   243 --GISNKINMFRKAKQNNF---TTFFSGPQQIRYMIDVDYDTLDHQNFITQFLIDGNLCLKNGKK 302

  Fly   351 HANTNRPFFGVFFGNGITNR--------SYDNAR---IQTELLDKVKKFKKMGILTQSIVVLFSY 404
            ..|......|.|..:...::        .||..|   |..:|...:...|:..|...:.:::.||
 Worm   303 LVNDQLEKIGAFLTSTADSKVFSAMFIDEYDEYRRQSIDQDLKKMLDLLKESNIFENTTLIITSY 367

  Fly   405 PVSSVKEKKTNFSQEDLPILYIWLPPWFKAFRP---------EIVQALRINSKRLTSPYDLHLTL 460
            .:|:...:..|...           |.| ||||         :.:..:.:|..||.|..:.:..|
 Worm   368 DLSTKDIENENDKY-----------PMF-AFRPSNQFIENNNQKLYFMNMNFNRLLSSTNFNQML 420

  Fly   461 QHLLELGERWPRAVDKLVDCPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQLSVG 525
            ..|:...|:            :.:::|...|.:|.|:..||.|:.|.|.:....|....|.....
 Worm   421 VELINPKEK------------SSKSVFIAQPTSRNCTSEGISENICLCMNMSTSSGYPEKGEKNF 473

  Fly   526 KQIVRSINEFLNHHNLHELCHNLTLKSVKM 555
            .|.:|:  .|......|:...:..|:..|:
 Worm   474 LQTLRT--RFTQEVKTHKCVRSFELEDYKI 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 95/534 (18%)
ALP_like 206..466 CDD:293745 54/301 (18%)
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49898
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.