DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and R03G8.3

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans

Alignment Length:696 Identity:128/697 (18%)
Similarity:237/697 (34%) Gaps:187/697 (27%)


  Fly    17 SHLSLSKKRNSQFNQVQHEHYIKTSECHIPYIN---KPLENEKGNIKKQHTICSKDESLINLRFD 78
            |.:.::|.....::|.:...|....:..:||:|   .|:.|           |:           
 Worm    56 SKVVMNKSEVEPWDQCELPQYDIWDDEILPYLNMEVNPISN-----------CN----------- 98

  Fly    79 EKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRDYIVDAPVVYVCYLTDRSLKF 143
             ||.:.|.::|:.    ....:.||:..:....|..|:.:|.|        |:            
 Worm    99 -KSREPLTFLNNG----SWGVVNKKTKLICRARCHTRKSERYN--------VI------------ 138

  Fly   144 EDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTF------VLVQPPKTYAPLISW 202
             ..:.|:.|           |.:.|.:.|.|     .|.:.|.:      |:..|||.....:|.
 Worm   139 -GNWTYTPG-----------PINCEVVEAVC-----ADGKKDVYGFLHTQVIATPPKQPTVKVSE 186

  Fly   203 HRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDG-----YTGIGENTQSNLMASLTGYS 262
            .:..:|.:|..|.:|....:|:.....:.:..    .||.     ...:|:|::.|..|...|.|
 Worm   187 LKNYDVTVIMLDSLSFTQAKRSLLRTISYMTN----HMDAVLFPYINKVGDNSRPNGAALWFGKS 247

  Fly   263 PHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEGISNLF-DSEKYGI--------FEGTI 318
            ..     |.|.|:.. .:.||:.|.|   ......|.:..::|| :.:.||.        .|||:
 Worm   248 LE-----KLDRSLFE-EENVPVDWSH---AYMCHVYKDNETSLFKEYQNYGYKTLMAEDWAEGTL 303

  Fly   319 DF-----------------------YARH---------KNLQSCIDRRFNIKHNYDYCEEFLKRH 351
            ::                       .|.|         ||.:.|.:....:   .||..:|:..:
 Worm   304 NWPNCKGFDKPPIDHLMRPFQNALERANHGEPLTKSHLKNQKYCREDHHTL---LDYLSQFINAY 365

  Fly   352 ANTNR------PFFGVFFGNGITNRSYDNARIQTELLDKVKKF--KKMGILTQSIVVLF-SYPVS 407
            .:.|:      ...|....||..:...|           ..||  |....|..|.|... .:.:.
 Worm   366 PDQNKFRWIWASILGHDSENGFPHSDKD-----------FHKFLIKHREQLDNSFVFFMGDHGLR 419

  Fly   408 SVKEKKTNFSQEDL--PILYIWLPPWFKAFRPE--IVQALRINSKRLTSPYDLHLTLQHLLELGE 468
            ....:||.....|:  |.|.:.:|   |..|..  ::..:|.|::::.:.:|...|:..:|:.  
 Worm   420 FGNVRKTFVGTLDVSNPFLAVSIP---KNLRQTTGLLNVMRENAQKIQTHFDTRATMLDILKY-- 479

  Fly   469 RWPRAVDKLVDCPTCQTLFAPVPEN-----------RTCSDAGIGESQCPCDSYKL-LSSNQMKQ 521
               ::.....|   ...|..|..:.           |.|.:..|....|.|...|. :|:.....
 Worm   480 ---QSASNFTD---LDPLIIPGEKGYSYIRTQPDILRNCRNMPIPMQYCICQFNKTQVSTKSETA 538

  Fly   522 LSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRKDRKLSSGSTYRAYFS-ANPNNAEFST 585
            ..||:.:..::|..:......:.|..:.:..|..:|| .|:|......|.|... ..|:.|.:..
 Worm   539 KGVGEAVALAVNNEIEEGKFTDKCVKMKVDHVVSLLQ-FDQKFKGSMLYTAVVEMTKPSKAVYKA 602

  Fly   586 TIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCICKSQ 631
            .::...| .|::.:.:  :.|.|.|.:.:.|:.....|.:|.||:|
 Worm   603 NVKILEN-GEVKVLGM--VERSNKYGSTAYCIGSEHHRPYCYCKNQ 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 100/565 (18%)
ALP_like 206..466 CDD:293745 60/319 (19%)
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 101/580 (17%)
ALP_like 190..480 CDD:293745 60/325 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50063
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.