DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and Y73F8A.35

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001255870.1 Gene:Y73F8A.35 WormBaseID:WBGene00013539 Length:654 Species:Caenorhabditis elegans

Alignment Length:549 Identity:119/550 (22%)
Similarity:203/550 (37%) Gaps:117/550 (21%)


  Fly   158 WNGYIVPPSVEGMRATCRNELAEDLQ----SDTFVLVQPPKTYAPLISWHRIPNVLLIGFDGISQ 218
            ||....|...|.:.|.|   |.::|:    ..:.::..||.|....:|..:..:|.:|..|.::.
 Worm   136 WNSTPGPVDCEFLEAIC---LKDNLKVYGYMHSQIIPTPPITPKVDVSKLQQYDVTVILLDSLAH 197

  Fly   219 INFRRNFPLVFNQLKMQDWFRMDGYTG-IGENTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTV 282
            ....|:.|...:.:.......:..|.. :|||::||.:....|.|..     |.|.|:.. .:.|
 Worm   198 AQALRSLPRAISYMTSHMSAVVFPYVNKVGENSRSNGVPLWFGKSLE-----KLDKSLFD-EEDV 256

  Fly   283 PLIWKH-----------------FKKKGFITA----YGEGISNLFDSEKYGIFEGTIDFYARHKN 326
            .:.|.|                 |:..|:.|.    :.||..| |.:.| |.....||.|.|  .
 Worm   257 TVDWTHEYMCNEFKDNETSIFNEFRDYGYKTLLAEDWAEGTLN-FPNCK-GFDNPPIDHYMR--P 317

  Fly   327 LQSCIDRRFN---IKHNY---------------DYCEEFLKRHANTNRPFFGVFFG-------NG 366
            .|:.::|..:   |..|:               :|..:|:..:.| .:.|..::..       ||
 Worm   318 FQNALERPHHGEFITRNHLSPGNLTREHHNTLLEYLSKFMNAYPN-EKKFSWIWASHLGHDSMNG 381

  Fly   367 ITNRSYDNARIQTELLDKVKKFKKMGILTQSIVVLFS--YPVSSVKEKKTNFSQE-DLPILYIWL 428
            .::...|......:..:|         |..|.|:|..  .|......|..:...| ..|.|.|.:
 Worm   382 FSHADNDFYNFLVKHREK---------LDNSFVILMGDHGPRFGANRKTVSGELEVHNPFLGISI 437

  Fly   429 PPWFKAFR--PEIVQALRINSKRLTSPYDLHLTLQHLLEL---------------GERWPRAVDK 476
            |   ||.|  .||:..::.|:|:|.:.||...|:..:|:.               ||:....:.|
 Worm   438 P---KALRKTTEILSLMKGNAKKLQTHYDTRATILDILKYQSTTNFLDTEILKIPGEKGFSFIRK 499

  Fly   477 LVDCP-TCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSS-NQMKQLSVGKQIVRSINEFLNHH 539
            ..|.| .|:|:..|:             ..|.|...:...| :.....|:.|.:..::|..|.:.
 Worm   500 QPDTPRNCKTMPIPI-------------QYCLCKFNRTTESIHSDLAHSMAKALTAAVNTELENG 551

  Fly   540 NLHELCHNLTLKSVKMVLQRKDRKLSSGSTYRAYFS-ANPNNAEFSTTIRYANNRQELEYINVES 603
            .|...|..:.. |:.:.|.|.|.|......|..... ..|:||.|...|:..:. .||:.:.:  
 Worm   552 KLQSRCIKMEY-SIILSLDRLDEKFRGSILYTIVVEMKKPSNAWFKANIKMLST-GELKVLGI-- 612

  Fly   604 INRLNNYQNDSSCMRRLRGRKFCICKSQI 632
            |.|:|.|...:.|::....|.:|.|::||
 Worm   613 IERVNEYGQTAHCIKSEYHRPYCFCRNQI 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 97/469 (21%)
ALP_like 206..466 CDD:293745 67/312 (21%)
Y73F8A.35NP_001255870.1 DUF229 89..557 CDD:281053 95/460 (21%)
ALP_like 185..475 CDD:293745 67/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50068
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.