DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9525 and Y41E3.1

Sequence 1:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001041024.1 Gene:Y41E3.1 WormBaseID:WBGene00012762 Length:682 Species:Caenorhabditis elegans

Alignment Length:702 Identity:156/703 (22%)
Similarity:278/703 (40%) Gaps:166/703 (24%)


  Fly    18 HLSLSKKRNSQFNQVQHEHYIKTSECHIPYI-------------NKPLENEKGNIKKQHTICSKD 69
            |....:.:....::...|..:::.:|:||.:             :.|||.:|.|..:.:.:...|
 Worm    60 HSDRDRHKGEDSSEKHAETALQSQKCNIPKLEINGSEVINFFKTHAPLECQKKNSIEDNWVFIND 124

  Fly    70 ESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYREL------KRLN-RDYIVD 127
            |::|  ||.||..:         |:.|::...:...|    |..|.|.      .|:| .||   
 Worm   125 EAII--RFTEKRAK---------AKCKIQYFSRVDDN----NNKYEEPVEVLDGDRMNGSDY--- 171

  Fly   128 APVVYVCYLTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTFVLVQP 192
              ....|....:..|   ..|:.:.:|          |.:.......|.|.|:          ..
 Worm   172 --ATISCIQGFQKWK---SILWDVNDE----------PEIHERARKMRKEQAD----------PE 211

  Fly   193 PKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQL-KMQDWFRMDGYTGIGENTQSNLMA 256
            .|.|          ||..:|||.:||::|||..|.....| :......::||..:|:.|....:.
 Worm   212 KKPY----------NVYFLGFDSLSQMSFRRKLPQTVKFLEETLGSVVLNGYNIVGDGTPQAFIP 266

  Fly   257 SLTGYS----PHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEGISNL--FDSEKYGIFE 315
            .||..:    |.|....|..:.|.   ...|.|||::..||::|.|.|...::  |.....|..:
 Worm   267 ILTAQTETELPLTRKRYKNANYVD---DVYPFIWKNYSDKGYVTMYAEDAFSIGTFTYRLKGFRQ 328

  Fly   316 GTIDFYAR-------HKNLQSCI------------DRRFNIKHNYDYCEEFLKRHANTNRPFFGV 361
            ...|.|.|       ..|.::||            .|:|..|  |:....||..|.:.       
 Worm   329 QPTDHYTRTLFEEVEKLNDRNCIGSIPLHRMWLQNGRQFMKK--YEDVPRFLLMHQSL------- 384

  Fly   362 FFGNGITNRSYDNARI----QTELLDKVKKFKKMGILTQSIVVLFS---YPVSSVKEKKTNFSQE 419
                    .|:|:..:    ..:|...:......|:...|:|::.:   :..:.:::......:|
 Worm   385 --------LSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVVIVMADHGHRFAKLRDTHQGQLEE 441

  Fly   420 DLPILYIWLPPWFKAFR-----PEIVQALRINSKRLTSPYDLHLTLQHLLELGERWPRAVDKLVD 479
            .:|...|.||   |..|     .::.|.||.|:::||||:|:|.:|..:|.|.|.....::::.|
 Worm   442 RMPFFSISLP---KQLRNTEKGRKMEQNLRENAEKLTSPFDIHASLMDILNLSELGENELNRMQD 503

  Fly   480 CPTCQTL--FAPVPENRTCSDAGIGESQCPCDSYK-LLSSNQMKQLS--VGKQIVRSINEFLNHH 539
            ..:.::|  |.|:|.:||||.|||....|.|.|:| .:.:.:.::|:  :...:||.||:.:...
 Worm   504 ASSKRSLSVFKPIPVDRTCSQAGIEPHWCTCLSWKDAMDTGEDRKLTRRIANAVVREINKEIVAE 568

  Fly   540 NLHELCHNLTLKSV---------KMVLQRKDRKLS-------SGST------YRAYFSANPNNAE 582
            .  :||..|:|..:         |.:|..|:.|.:       ||||      |:......|..|.
 Worm   569 K--DLCAPLSLAKIIDAKKLLPDKGLLAYKNVKDADGFVPDLSGSTKAAFAHYQLKLQTTPGEAI 631

  Fly   583 FSTTIRYANNRQELEYINVESINRLNNYQNDSSCM--RRLRGRKFCICKSQI 632
            :..|:.|...|.|:: ::..|::.:|.:.:...|:  :......||:|..::
 Worm   632 YEVTLFYDIVRDEVK-LDFGSMSHVNKFGDTPHCIIDKNYYLATFCVCYDRV 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9525NP_609260.1 DUF229 66..554 CDD:281053 125/547 (23%)
ALP_like 206..466 CDD:293745 71/298 (24%)
Y41E3.1NP_001041024.1 DUF229 78..581 CDD:281053 133/581 (23%)
ALP_like 215..491 CDD:293745 73/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.