DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and CD63

DIOPT Version :8

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens

Alignment Length:237 Identity:76/238 (32%)
Similarity:127/238 (53%) Gaps:12/238 (5%)


  Fly     6 GSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISF 70
            |....||:.|:...|.|....:.|||||.|...|.:...:..|.....:|..:|.:|.|:.:::|
Human     5 GGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAF 69

  Fly    71 FGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNAT 135
            .||.||.||||||:::|::.|::|.::|:||.|:|||.|:........:....:..|.  ..|.|
Human    70 VGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYP--KNNHT 132

  Fly   136 TKLWDDIQDEFECCGVTSYNDW--ITAFPNGDLPISCC-NVHVGAVGTFTCNNAQSSVADRHKVG 197
            ..:.|.:|.:|:|||..:|.||  |.:.....:|.||| ||.||....|.    :.::   ||.|
Human   133 ASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFN----EKAI---HKEG 190

  Fly   198 CLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            |::...|::..:.:.:.||.:.||.::..|::|||.:.:.|:
Human   191 CVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIR 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 74/230 (32%)
tetraspanin_LEL 106..210 CDD:239401 30/107 (28%)
CD63NP_001244318.1 MAP17 33..>70 CDD:318101 8/37 (22%)
CD63_LEL 105..203 CDD:239419 30/107 (28%)
Lysosomal targeting motif. {ECO:0000250|UniProtKB:P41731} 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQQH
Hieranoid 1 1.000
Homologene 1 1.000 H37526
Inparanoid 1 1.050 139 1.000 Inparanoid score I4430
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131579
Panther 1 1.100 O PTHR19282
Phylome 1 0.910 0.705 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4418
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.