DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and AT2G20740

DIOPT Version :8

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_179667.2 Gene:AT2G20740 / 816603 AraportID:AT2G20740 Length:221 Species:Arabidopsis thaliana

Alignment Length:47 Identity:11/48 (23%)
Similarity:24/48 (50%) Gaps:6/48 (13%)


  Fly    54 IPTFL---IVIGSFIIIISFFGCWGALKENYC---LVLSFSVMLAII 94
            :|.|:   :.:|:.:.:::..|...|...|.|   |.:.|.|:|.::
plant    54 VPWFIYSFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLTMV 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 11/48 (23%)
tetraspanin_LEL 106..210 CDD:239401
AT2G20740NP_179667.2 Tetraspannin 8..>144 CDD:278750 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19282
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.