DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp26A

DIOPT Version :8

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster

Alignment Length:246 Identity:60/247 (24%)
Similarity:117/247 (47%) Gaps:43/247 (17%)


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSI-PTF-LIVIGSFIIIISFFGC 73
            :||.||..|:|..::.:::::||....:....::......|.:: |.| ||::|....::.|.|.
  Fly    19 LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGFMGS 83

  Fly    74 WGALKENYCLVLSFSVMLAIIFILELAAGISGYVL------RNDASDLIKTSLTYSLNEYNSINP 132
            .|||:||.||:.::::.|:::.|.|:......:||      ::.|::.:|..:.:...:.:..| 
  Fly    84 VGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQN- 147

  Fly   133 NATTKLWDDIQDEF-ECCGVTSYNDWITAFPNGDLPISCCNVHVG---AVGT-FTC--------- 183
                 |.|.||::: :|||:....||     :.:...:|.::.:|   |.|. |:|         
  Fly   148 -----LIDWIQEDWLQCCGIDGPKDW-----DSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVI 202

  Fly   184 NNAQSSV--------ADR--HKVGCLDGFSGYISAHAVSLGAAGVVIAILQ 224
            .|.|...        .||  |:.|||.....::.||.:|:....|.:.:||
  Fly   203 KNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQ 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 60/247 (24%)
tetraspanin_LEL 106..210 CDD:239401 30/134 (22%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 59/245 (24%)
DUF2207 <65..157 CDD:303056 25/98 (26%)
TM4SF9_like_LEL 118..239 CDD:239412 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122035941
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.