DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp3A

DIOPT Version :8

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster

Alignment Length:265 Identity:64/266 (24%)
Similarity:123/266 (46%) Gaps:37/266 (14%)


  Fly     8 ANAVKYTLFGFNLIFLITGIILIAVGA-----------GVGAVYTGYKLFLAGKFFSIPTFLIVI 61
            :..|||.:|..|.:|.:.|.:|:.:|.           |...:...|.:||     :|...:|:.
  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFL-----NISLVMILA 99

  Fly    62 GSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNE 126
            |:.|.::||.||.|||:||..|:..:|:.|.:.|:||:|..|..:|.....:..::...|:.:..
  Fly   100 GTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIH 164

  Fly   127 YNSINPNATTKLWDDIQDEFECCGVTS--YNDWI------TAFPNGD---LPISCC----NVHVG 176
            ....:|:....: |..|.||:|||:::  |.||.      .:.|:.:   :|.|||    ::..|
  Fly   165 SYRDDPDLQNFI-DFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSG 228

  Fly   177 AVGTFTCNNAQSS-VADRHKV----GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAR 236
            .|........|:: |.:..|:    ||::....:...:...:....:.||::|...:..|..:..
  Fly   229 LVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEG 293

  Fly   237 EIKIR 241
            :|:::
  Fly   294 QIELQ 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 63/258 (24%)
tetraspanin_LEL 106..210 CDD:239401 25/124 (20%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 63/259 (24%)
penumbra_like_LEL 144..267 CDD:239411 25/124 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122034777
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.