DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and AT5G66150

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_201416.1 Gene:AT5G66150 AraportID:AT5G66150 Length:1047 Species:Arabidopsis thaliana

Alignment Length:1088 Identity:364/1089 (33%)
Similarity:558/1089 (51%) Gaps:152/1089 (14%)


  Fly     4 LCGIVLFVALLAISVRPSEEACGY-----EACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGH 63
            ||.||.   ||.:|:..|.:..||     ||  |.....:|:|:|||||||||||||||||:.|.
plant    13 LCVIVF---LLLLSLVESVKGGGYVKYGTEA--KVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGS 72

  Fly    64 RSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGG 128
            .:.||:|.|:.::|:|:..|::||.|:|:..|.:||.:||.|||...::.||:||..|:|||..|
plant    73 NNRIQNACVRNVLDSVVDSLLRDPNRKFVFAEMAFFTRWWEEQSPERQEQVRRLVKSGQLEFVNG 137

  Fly   129 AWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIF-AQMGYDGEF 192
            .|:|||||..:|..:|||.|.|.:|:...|.:  .||..|||||||||..||.:. |::|.|...
plant   138 GWAMNDEATCHYIDMIDQTTKGHRFIKQQFNT--TPRAAWQIDPFGHSSVQAYLLGAELGLDSVH 200

  Fly   193 FARMDHRDKNDRIDNLGMEMIWDASDSL-SNDEIFTGLLYRHYSAPPGYCFDVHCGDD--PIIDT 254
            |||:|::|:..|.....:|:||..|.:| |:.:|||.:.:.||..|.|:.::|  .||  |:.|.
plant   201 FARIDYQDREKRKAEKSLEVIWRGSKTLDSSSQIFTNIFFVHYGPPTGFHYEV--TDDYVPLQDN 263

  Fly   255 KSYDN-NVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEG 318
            ..:|. |:|..|:||::.....|...|.||:|..|||||||:.|:..|:.||:||.|||:   :|
plant   264 PRFDGYNIKEAVNDFVNASLVYANVSRGNHVMWTMGDDFQYQFAESWFRQMDRLIHYVNK---DG 325

  Fly   319 STFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQV 383
            .. |..||||:.|:::.:....|||.||.|||||.....:||||||||||..||:.|..:.....
plant   326 RV-NALYSTPSLYVDAKNVANVTWPLKTHDFFPYADRAYAYWTGYFTSRPALKRYVRALSGYYMA 389

  Fly   384 AKQLSVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGG------V 442
            |:||......|:  ...:...|.:.:|:.|||||:|||.||||::||.:.|   .||.      |
plant   390 ARQLEFLVGKNS--GGPNTYSLGDALGIAQHHDAVTGTAKQHVTNDYMKRL---ALGASEAEAVV 449

  Fly   443 NTARDGLRKLTNLPNGE--------FESCLQLNISECAFTKD---DADNVVVTLYNPLAHTSTQY 496
            |:|...|  :...|.|.        .:.|..:|||.|..|::   ...::::..||.|....|:.
plant   450 NSALACL--MNKAPKGGCTKPAIAFSQQCSLMNISYCPSTEETLPGQKSLILVAYNSLGWNRTEI 512

  Fly   497 VRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDT------------QHELVFKASVDK 549
            :|:||.:....|.|..|..:.::.:|:  ..:....|:..|            ::.|||||.|..
plant   513 IRIPVNDAGLSVEDSSGNTLDAQYIPM--DNVTSNLRSFYTKAYLGISSLQRPKYWLVFKAKVPP 575

  Fly   550 IA--NYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQ 612
            :.  .::|.|.::|.:.|   |..|  |:.....|              |.||          :.
plant   576 LGWNTFFISKASAQGSNN---HKHS--SVMLSPMN--------------NTTE----------IG 611

  Fly   613 TSQVKLVIDNKTGLLKTV--EMNGVSENIDQSYGVYRT--------YDSGAYVFRQYHQADFIVQ 667
            ...:|:|..:.:|.|:.:  ...|....:||:|..|.:        ..||||:||......:.|.
plant   612 PGNLKMVFSSDSGRLERMYNSRTGADIKVDQNYFWYASNVGDAKDPQVSGAYIFRPNGSLAYPVS 676

  Fly   668 YEGV---------------EFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIE-- 715
            ...:               :..:..|.|:.|||||||.:::||:|:|:.|...|.|:.:|||.  
plant   677 SSKICTVTSAFIGNGNVQSKLQIVRGPLIDEVHQQFSPWVAQVVRLYKEKEHAEFEFTIGPISVG 741

  Fly   716 REEEFGREVV--IIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRI 778
            :....|:|::  ::.:.|.|.:  .|||||||:.:|||:|.|..:...:: :|.|.||||:...:
plant   742 KGHLTGKEIITRMVTDMTTAKE--FYTDSNGRDFLKRVRDNRTDWHLEVN-EPIAGNYYPLNLGM 803

  Fly   779 ALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEAL------NEEKYGQPMIAR 837
            .::|.|..::||.|||.||||:.:|::|||||||...||..||.|:|      |:...|  :..|
plant   804 YIKDEKAELSVLVDRATGGASIKDGEIELMLHRRTSMDDSRGVEESLVETVCVNDTCAG--LTIR 866

  Fly   838 GKVYLILSPSDESTAAEREAEKEIHLPFWKFFS-----KNTGSTTAAAKSVPSFNDFPKSVHLLT 897
            |..|:.::...|.....||..:||:.|....|:     |...|.|....::......|:::.|:|
plant   867 GNYYVSINKVGEGGRWRRETGQEIYSPLLMAFAHENKEKWKASNTVKGYAMDHLYTLPQNIALIT 931

  Fly   898 LEPFNDDEVLLRVENFLDHTE----GQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMK-RFKF 957
            ||..:...||||:.:..:..|    .::....::.:|......|:.|.:|..|.....|| :.|:
plant   932 LEELDLGNVLLRLAHLYEAGEDSDYSKIAKVELKKLFSGKMIKEVTEMSLSANQEKVKMKEKMKW 996

  Fly   958 HHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            ..:...::|.:         ||.. ...:.|...|.|.||:||||:::
plant   997 KVEGEAEQPSS---------PLRG-GPVDKSTLVVELGPMEIRTFVVQ 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 128/279 (46%)
Alpha-mann_mid 359..434 CDD:286360 33/75 (44%)
Glyco_hydro_38C 482..1002 CDD:285047 156/579 (27%)
AT5G66150NP_201416.1 GH38N_AMII_LAM_like 47..323 CDD:212121 129/280 (46%)
Alpha-mann_mid 365..438 CDD:214875 33/75 (44%)
Glyco_hydro_38C 498..1031 CDD:285047 156/579 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.722 Consistency score
87.980

Return to query results.
Submit another query.