DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and AT5G13980

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_196902.2 Gene:AT5G13980 AraportID:AT5G13980 Length:1024 Species:Arabidopsis thaliana

Alignment Length:1060 Identity:386/1061 (36%)
Similarity:569/1061 (54%) Gaps:107/1061 (10%)


  Fly     2 KYLCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSN 66
            |:||.|||   ||.||:..|.... |..........:|:|:|||||||||||||||||:.|..::
plant     5 KFLCWIVL---LLGISLVESRYMV-YNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNS 65

  Fly    67 IQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWS 131
            ||.|.||.::|:::..|:.|..|:||.||.:||.:||.||||..|::|::|::.|:||...|...
plant    66 IQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSEEIKRIVKELIHSGQLELINGGMC 130

  Fly   132 MNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIF-AQMGYDGEFFAR 195
            |:||||.:|..:|||.|||.:|:...|.  ..|||||||||||||..||.:. |::|:|..||.|
plant   131 MHDEAAPHYIDMIDQTTLGHRFIIREFN--VTPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGR 193

  Fly   196 MDHRDKNDRIDNLGMEMIWDASDSL-SNDEIFTGLLYRHYSAPPGYCFDVHCGDDPII--DTKSY 257
            :|::|:..|.....:|:||..|.|| |:.:||.|....:|..|||..:.....|.|::  |...:
plant   194 IDYQDREKRYKEKTLEVIWRGSKSLGSSSQIFAGAFPTNYEPPPGGFYYEITDDSPVVQDDPDLF 258

  Fly   258 DNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFN 322
            |.||:.||:.|::.....|...|.||||..||.||:|:.|...::.|||||.|||   .:|.. |
plant   259 DYNVQERVNAFVAAALDQANITRINHIMFTMGTDFRYQYAHTWYRQMDKLIHYVN---LDGRV-N 319

  Fly   323 LFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQL 387
            .|||||:.|.::.|...:.||.||:|:|||....|:||||||||||..||:.|..:.....|:||
plant   320 AFYSTPSIYTDAKHAANEAWPLKTEDYFPYADRINAYWTGYFTSRPALKRYVRVMSAYYLAARQL 384

  Fly   388 SVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKL 452
            ..|.  ...|:..:.:.|.:.:.:.|||||::||.||||::||.:.|....:...:.....|..|
plant   385 EFFK--GRSQKGPNTDSLADALAIAQHHDAVSGTSKQHVANDYAKRLAIGYVEAESVVATSLAHL 447

  Fly   453 TNLP---NGEFESCLQLNISECAFTK---DDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDE 511
            |.:.   |..|:.||.||||.|..::   .|..:::|..||||.......||:||...:..|.|.
plant   448 TKVDPTLNPTFQQCLLLNISYCPSSEVNLSDGKSLIVLAYNPLGWKRVDIVRLPVVGGDVSVHDS 512

  Fly   512 KGRVVASEVVPVAWQVLALE-------FRNNDTQ---HELVFKASVDKI--ANYYIKKVASQETK 564
            :|..|.|::||...:.:||.       ...:.||   :.|||..:|..:  ..|.|.  .:::|.
plant   513 EGHEVESQLVPFTDEYVALRKYHVEAYLGQSPTQVPKYWLVFSVTVPPLGFTTYTIS--TAKKTD 575

  Fly   565 NVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKT 629
            ..::.:.....:|.|::.:.:.....|:        :|..|:|..:       ..::.:|.:   
plant   576 GYSSKSYVSNILKGEQSIINIGHGHLKL--------SFSTDQGTAI-------NYVNGRTSM--- 622

  Fly   630 VEMNGVSENIDQSYGVYRTY------------DSGAYVFRQYHQADFIVQYEG-VEFTVYDGALV 681
                  :|.:.|::..|..|            :|||||||.  ...|.:..|| |..||..|.||
plant   623 ------TEPVKQTFSYYSAYNGSNDKEPLIPQNSGAYVFRP--NGTFPINPEGQVPLTVIHGPLV 679

  Fly   682 KEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGRE 746
            .|||||.:.:|||:.|:|:||..||:|:.||.|..::..|:|||...:|::.|:...||||:||:
plant   680 DEVHQQINPWISQITRVYKGKEHVEVEFIVGNIPIDDGIGKEVVTQISSSLKSNKTFYTDSSGRD 744

  Fly   747 MIKRVKDQRETFTPGLD-RQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLH 810
            .|||::|.|..:.  || .||.|.||||:...|.||||||..:|:.|||.||:|:::||:|||||
plant   745 YIKRIRDYRSDWK--LDVNQPIAGNYYPINHGIYLQDSKKEFSVMVDRAFGGSSIVDGQVELMLH 807

  Fly   811 RRLVRDDGYGVGEALNEEKYGQP----MIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSK 871
            |||:.||..||.|.|||....|.    :..:||.|..:.|..|.....|...:||:.|....|::
plant   808 RRLLLDDSRGVAENLNETVCVQDKCTGLTIQGKYYYRIDPYGEGAKWRRTFGQEIYSPLLLAFAQ 872

  Fly   872 NTG----STTAAAKS--VPSFNDFPKSVHLLTLEPFNDDEVLLRVENFLDHTEGQ----VVSFNI 926
            ...    |..||:.|  .||:: .|.:|.||||:..:|..||||:.:..:..|.:    |.|..:
plant   873 QDDGKPMSFGAASFSGIDPSYS-LPDNVALLTLQELDDGNVLLRLAHLYEVEEDKELSGVASVEL 936

  Fly   927 RPIFDYLNGVEIRETTLDGNLPLSDM--KRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEAS- 988
            :.:|......::.|.:|..|...|.|  ||..:..:..|          |..:...|::.:|.. 
plant   937 KKLFPGKKIGKLTEMSLSANQERSTMEKKRLVWKVEGEG----------SYGEEKKAKRGREIDP 991

  Fly   989 -EFSVTLHPMQIRTFIIKTE 1007
             :..:.|:||:|||.:|..|
plant   992 RKLEMELYPMEIRTVLIHLE 1011

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 128/278 (46%)
Alpha-mann_mid 359..434 CDD:286360 32/75 (43%)
Glyco_hydro_38C 482..1002 CDD:285047 179/564 (32%)
AT5G13980NP_196902.2 GH38N_AMII_LAM_like 37..313 CDD:212121 128/278 (46%)
Alpha-mann_mid 356..429 CDD:214875 32/75 (43%)
Glyco_hydro_38C 594..1006 CDD:285047 150/451 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.722 Consistency score
87.980

Return to query results.
Submit another query.