DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and AT3G26720

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_189306.1 Gene:AT3G26720 AraportID:AT3G26720 Length:1019 Species:Arabidopsis thaliana

Alignment Length:1060 Identity:374/1061 (35%)
Similarity:571/1061 (54%) Gaps:128/1061 (12%)


  Fly     9 LFVALLAISV-RPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGV 72
            |::.|.||.: ..:.|...|...|:.....||:|:|||||||||||||||||:.|..::|:.|.|
plant     8 LYLILAAIVIGGVTSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIRGACV 72

  Fly    73 QYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAA 137
            |.::|:|||.|:.|..|:||.||.:||.:||.:||...|..|:|||:.|:|||..|...|:|||.
plant    73 QNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEFINGGMCMHDEAT 137

  Fly   138 VNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIF-AQMGYDGEFFARMDHRDK 201
            .:|..:|||.|||.:|:...||..  ||:||||||||||..||.:. |:.|:|..||||:|::|:
plant   138 PHYIDMIDQTTLGHQFIKTEFGQV--PRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDR 200

  Fly   202 NDRIDNLGMEMIWDASDSL-SNDEIFTGLLYRHYSAPPGYCFDVH-----CGDDPIIDTKSYDNN 260
            ..|:....:|:||..|.|| |:.:||||:..|||..|.|:.|:::     ..|||::    :|.|
plant   201 AKRLREKTLEVIWQGSKSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLL----FDYN 261

  Fly   261 VKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFY 325
            |:.||:||::...:.....|:||||..||.||:|:.|...|:.:||.|.|||    :....|:.|
plant   262 VQERVNDFVAAALAQVNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVN----KDGRLNVLY 322

  Fly   326 STPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVF 390
            |||:.|.::.:...::||.||.|||||....|:||||||||||..|::.||.:.....|:||...
plant   323 STPSIYTDAKYAANESWPLKTDDFFPYADKPNAYWTGYFTSRPAFKKYVRDLSGYYLAARQLEFL 387

  Fly   391 AELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYD-RI---------LYDAILGGVNTA 445
            ...::.....|:  |.:.:.:.|||||::||::|||:.||. |:         |..:.|..::.|
plant   388 RGRDSSGPTTDM--LADALAIAQHHDAVSGTQRQHVAADYALRLSMGYLQAEKLVASSLSFLSAA 450

  Fly   446 RDGLRKLTNLPNGEFESCLQLNISECAFTKD---DADNVVVTLYNPLAHTSTQYVRVPVKNENYE 507
            :....|..  |..:|:.|..||||.|..::.   ...::||.:||.|.....:.|||||.:||..
plant   451 KSSTEKKN--PGTKFQQCPLLNISYCPASEARLLSGKSLVVVVYNSLGWKREEVVRVPVSSENVI 513

  Fly   508 VTDEKGRVVASEVVPVAWQVLALEFRN-----------NDT-QHELVFKASVDKI--ANYYIKKV 558
            |.|..|:.|..:::|::  .:||..||           .|| :|.|.|.|||..:  ::|.|...
plant   514 VKDASGKEVVFQLLPLS--EIALRIRNEYVKAYLGRSPRDTAKHVLAFTASVPPLGFSSYVISDT 576

  Fly   559 ASQETKNVAAHTKS---KRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVI 620
            ........|::..|   .::::..:.||::  |:              .:||..:.:....|   
plant   577 GRTARGLSASYVTSGSMNQNVEVGQGNLKL--RY--------------SEEGVKITRHLSTK--- 622

  Fly   621 DNKTGLLKTVEMNGVSENIDQSYGVY--------RTYDSGAYVFRQYHQADFIV---QYEGVEFT 674
                        |.|:  .:|||..|        ....|||||||    .|.::   ..|..:.|
plant   623 ------------NQVT--AEQSYAYYIGSNGTDKDPQASGAYVFR----PDGVLPIKSKEEAQLT 669

  Fly   675 VYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSY 739
            :..|.|..||||:.:.:|||:.|:|:|||..|||:.:|||..::...:|::....:|:.::|..|
plant   670 IVQGPLFDEVHQELNSWISQITRVYKGKNHAEIEFTIGPIPADDGISKEIITKLTTTMKTNGTFY 734

  Fly   740 TDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQ 804
            ||||||:.|||::|.|..:...: .||.|.||||:...|.:||....::||.|||.||:|:.|||
plant   735 TDSNGRDFIKRIRDFRTDWDLQV-YQPVAGNYYPLNLGIYMQDKTSELSVLVDRAVGGSSLENGQ 798

  Fly   805 LELMLHRRLVRDDGYGVGEALNE----EKYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPF 865
            :|||||||:..||..||||.|||    .:..:.:..:||.|:.:....:.....|...:||:.|.
plant   799 IELMLHRRMQHDDIRGVGEILNETVCLPEGCKGLTIQGKFYVQIDKPGDGAKWRRTFGQEIYSPL 863

  Fly   866 WKFFSKNTGST------TAAAKSVPSFNDFPKSVHLLTLEPFNDDEVLLRVENFLDHTEGQ---- 920
            ...|::..|.:      |..:...||:: .||:|.||||:...:.|||||:.:..:..|..    
plant   864 LIAFTEQEGDSWINSHKTTFSAFEPSYS-LPKNVALLTLQELENGEVLLRLAHLFEVGEDSEYSV 927

  Fly   921 VVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQ 985
            :....::.:|......|::||:|.||...::|::.:......|          ||.:.:...::.
plant   928 MAKVELKKLFHNKKIREVKETSLSGNQEKAEMEKRRLIWKVEG----------SAGEEVKRGEAV 982

  Fly   986 EASEFSVTLHPMQIRTFIIK 1005
            :|.:..|.|.||:|||.:||
plant   983 DAEKLVVELVPMEIRTLLIK 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 134/281 (48%)
Alpha-mann_mid 359..434 CDD:286360 31/85 (36%)
Glyco_hydro_38C 482..1002 CDD:285047 171/562 (30%)
AT3G26720NP_189306.1 PLN02701 36..997 CDD:178304 363/1026 (35%)
GH38N_AMII_LAM_like 38..314 CDD:212121 135/286 (47%)
Alpha-mann_mid 356..429 CDD:214875 31/75 (41%)
Glyco_hydro_38C 488..999 CDD:285047 171/562 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.718 Consistency score
87.980

Return to query results.
Submit another query.