DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2b1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001072469.1 Gene:man2b1 XenbaseID:XB-GENE-958698 Length:995 Species:Xenopus tropicalis

Alignment Length:1026 Identity:415/1027 (40%)
Similarity:587/1027 (57%) Gaps:78/1027 (8%)


  Fly     7 IVLFVALLAISVRPSE-EACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHA 70
            ::|.:.||..:.|..: |.||.::||:.....:|:|::||:|:|||||||||||:||..::||||
 Frog     7 LLLPLLLLGAAGRLKQAEGCGEQSCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHA 71

  Fly    71 GVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDE 135
            |||||:|:|:::|:.||::|||.||::||.:||.:|.|..::.|.:||.||||||..|.||||||
 Frog    72 GVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDE 136

  Fly   136 AAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRD 200
            ||.:|.|:|||.||||:||..|||.|.|||:.|.|||||||||||.:||||||||.||.|:|::|
 Frog   137 AATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQD 201

  Fly   201 KNDRIDNLGMEMIWDASDSLSND--EIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKSY-DNNVK 262
            |.:|.....|||:|.|||.:|..  ::|||:|...|:.|.|:|:|..|.|.||||..|. |.|..
 Frog   202 KANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNAD 266

  Fly   263 SRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYST 327
            ..|..||...|..||.|.|:||::.||.|||||:|.:.|||||:|||.||.:|..||..|:||||
 Frog   267 VIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYST 331

  Fly   328 PACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE 392
            |:|||.|||....|||.|..|||||....:.:|||||||||..|.:||..|:.|||..|:...:.
 Frog   332 PSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALSG 396

  Fly   393 L---NTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTN 454
            |   |....:.....:|..|||.|||||:|||.||||::||...|.:..........:.|..||.
 Frog   397 LEARNGPYGQSSSTVMRRAMGVAQHHDAVTGTAKQHVNNDYSLRLSEGWDSCQVVISNSLSSLTG 461

  Fly   455 LPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASE 519
            ... .|..|..||||.|..| :.|:|..|.|||||..:.|..||:||....|:|.......|.||
 Frog   462 TKE-NFAFCNLLNISVCHVT-ETANNFKVYLYNPLGRSVTWTVRLPVNGHAYKVIGPNDETVPSE 524

  Fly   520 VVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLE 584
            ||.|:....||.|:....:.||:|:..:..:              ..::.|..|         |.
 Frog   525 VVDVSDFTKALRFQQGGAERELIFQGQIPAV--------------GFSSFTVGK---------LS 566

  Fly   585 VPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVE--MNGVSENIDQSYGVYR 647
            :|.||    .:|........|:    :|....::..|.:|||:..:.  ...:|..:.||:..|.
 Frog   567 LPDRF----VIKGKRGKKQPDK----IQNQYYRVDFDPETGLISGIHNLEKKISLPLKQSFYWYN 623

  Fly   648 --------TYDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNL 704
                    :..||||:||. :.:|.:...:.|...:...:||:||||.||.:.|||:|:|..:..
 Frog   624 ASVGNEESSQPSGAYIFRP-NNSDSVPVSQHVRSYLVQNSLVQEVHQNFSSWCSQVVRLYRDQRY 687

  Fly   705 VEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAA 769
            :|:||.|||:...:|:|:||:.:..:.:.:|||.|||||||:::||.:|.|||:... ..:|.|.
 Frog   688 IELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLN-QTEPIAG 751

  Fly   770 NYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEE-KYGQP 833
            |||||.|||.::....::.||.||:|||:|:.:|.||||:||||:|||..||||.|.|. ..|:.
 Frog   752 NYYPVNSRIYIKGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEG 816

  Fly   834 MIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSKNTG-----STTAAAKSVPSFNDFPKSV 893
            ::.||:..|:|..:||:....|....:.::......|...|     |.|...|......:.|::.
 Frog   817 IVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNG 881

  Fly   894 HLLTLEPFNDDEVLLRVENFLDHTE----GQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKR 954
            ||||......|::|||:|:.....|    .|.::.|:..:|..::.....||||..|:..|.:||
 Frog   882 HLLTFAMHAADKILLRLEHPFQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKR 946

  Fly   955 FKFHHDSSGQKPDAVEYFTSAHKPLAAE--QSQEASEFSVTLHPMQIRTFI 1003
                          :::.|....||..:  ::......::||.||:||||:
 Frog   947 --------------LQWRTRTGSPLQMDSPRAPVVDPSNITLSPMEIRTFL 983

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 159/277 (57%)
Alpha-mann_mid 359..434 CDD:286360 37/78 (47%)
Glyco_hydro_38C 482..1002 CDD:285047 170/542 (31%)
man2b1NP_001072469.1 PLN02701 39..987 CDD:178304 406/995 (41%)
GH38N_AMII_LAM_like 39..317 CDD:212121 160/278 (58%)
Alpha-mann_mid 363..441 CDD:214875 37/78 (47%)
Glyco_hydro_38C 585..982 CDD:285047 137/413 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64876436
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.