DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2b1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_005169420.1 Gene:man2b1 ZFINID:ZDB-GENE-050327-52 Length:984 Species:Danio rerio

Alignment Length:1070 Identity:425/1071 (40%)
Similarity:597/1071 (56%) Gaps:172/1071 (16%)


  Fly     7 IVLFVALLAISVRPSEEA-CGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHA 70
            ::||...|..|:.....: |||::||.||.:|:|:|:|||:||||||||||||||||.|:|||||
Zfish    12 LLLFCFSLVFSLPTGRNSICGYKSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHA 76

  Fly    71 GVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDE 135
            |||||:|:||.:|.||||||||.|||:||.:||.:|::..:::|.:|||||||||..|.|.|:||
Zfish    77 GVQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDE 141

  Fly   136 AAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRD 200
            |..:|.:||||.||||:||:||||.|.|||:.|.||||||:||.|||||||||||.||.|:|::|
Zfish   142 ATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQD 206

  Fly   201 KNDRIDNLGMEMIWDASDSLSND--EIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKSY-DNNVK 262
            |:.|:....|||:|.||:||:..  ::|||:|...|:.|.|:|:|..|.|.||.|.... |.||.
Zfish   207 KDRRMKTKEMEMLWRASESLTPPIADLFTGVLPNGYNPPEGFCWDQSCDDAPIRDDPDLEDYNVD 271

  Fly   263 SRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYST 327
            ..|..||:.....|.:|::|||::.||.|||||:|.:.:|||||||||||..||:||..|:.|||
Zfish   272 EIVQKFLNASHKQADYYKTNHIIMTMGSDFQYENANLWYKNMDKLIKYVNALQAKGSKLNVLYST 336

  Fly   328 PACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSV--- 389
            |:|||..|:....|||.||.|||||..|.:.:|||||||||..|.:||..|..||...||.|   
Zfish   337 PSCYLQELNLANFTWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVLGG 401

  Fly   390 -------FAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYD----------- 436
                   |.|       .|.:.:|..|||.|||||::|||||||::||.|.|..           
Zfish   402 PTSTSGPFGE-------GDSDTMRRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSN 459

  Fly   437 --AILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRV 499
              |:|.|....|              ..|..||||.|..| :.:....:.:||||..|....||:
Zfish   460 SLAVLSGSEAPR--------------VFCENLNISVCPLT-ESSHKFSMNVYNPLGRTVRWPVRL 509

  Fly   500 PVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKI--ANYYIKKVASQE 562
            ||....|.|||..|:.|.|||:|::.....:.......:.||||:.....:  :.|.|..|..|.
Zfish   510 PVNGSVYNVTDANGKAVDSEVIPLSKSRKEVRQNRGFAKSELVFQVEAPPLGYSTYIISMVQDQP 574

  Fly   563 TKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLL 627
            ..     ::||.::.:.                               :|...:|:..|:.||||
Zfish   575 PV-----SRSKNAVPSS-------------------------------IQNKFLKVTFDSTTGLL 603

  Fly   628 ---------KTVEM-------NGVSENIDQSYGVYRTYDSGAYVFRQYHQADFIV----QYEGVE 672
                     :|:.:       |..:.|..:|:     ..||||:||......||:    :.:.| 
Zfish   604 SSLTNLETQQTIRLTQNFFWYNASAGNNKESH-----QPSGAYIFRPNSSDPFIISKTAEIQAV- 662

  Fly   673 FTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGV 737
             ::|:.  |:||.|:||.::|||:|:||.:..:|:||.|||:..|:..|:||:...::.|.|.|.
Zfish   663 -SLYNS--VQEVTQRFSPWVSQVVRLYEDRRELELEWTVGPVPVEDGLGKEVITRLDTDIQSSGY 724

  Fly   738 SYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLN 802
            .||||||||:::|.||.|.|:.. ...:|.|.||||:.||..::|.|:::.|:.||:||.:|:.|
Zfish   725 FYTDSNGREVLERRKDYRPTWDL-KQTEPIAGNYYPINSRAYIKDDKRQLTVVTDRSQGASSIYN 788

  Fly   803 GQLELMLHRRLVRDDGYGVGEALNEE-KYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPFW 866
            |.||:||||||:.||..||||.|:|. ::...::|||::.|.|||.        ||..::|.|. 
Zfish   789 GSLEIMLHRRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLLTLSPP--------EAAADLHRPL- 844

  Fly   867 KFFSKNTGSTTAAAKSVPSFND-----------------FPKSVHLLTLEPFNDDEVLLRVENFL 914
                    :.:...:.:.||.|                 .|.:|||||:..::.|.||:|:|:..
Zfish   845 --------AQSMVLQPLLSFQDGAPSPGTKLEFSGLQAALPPAVHLLTVSQWDQDSVLVRLEHQY 901

  Fly   915 ----DHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSA 975
                ..|..|.|:.|::.:|..|..:...|.:|..|....||.|..::.:.....|.|       
Zfish   902 QAKESKTHSQPVTVNLQKLFSTLQVLGASEMSLGANQWKEDMIRLHWNTEKDALPPTA------- 959

  Fly   976 HKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
                     ::.|.:.|||.||:||||:::
Zfish   960 ---------RDPSSWEVTLKPMEIRTFLLR 980

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 165/277 (60%)
Alpha-mann_mid 359..434 CDD:286360 40/85 (47%)
Glyco_hydro_38C 482..1002 CDD:285047 170/564 (30%)
man2b1XP_005169420.1 PLN02701 44..982 CDD:178304 413/1039 (40%)
GH38N_AMII_LAM_like 44..322 CDD:212121 166/278 (60%)
Alpha-mann_mid 368..446 CDD:214875 40/85 (47%)
Glyco_hydro_38C 558..977 CDD:285047 147/498 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64829752
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.