DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2a2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001006777.1 Gene:man2a2 XenbaseID:XB-GENE-981388 Length:909 Species:Xenopus tropicalis

Alignment Length:808 Identity:226/809 (28%)
Similarity:363/809 (45%) Gaps:155/809 (19%)


  Fly    31 PKTKTN-MINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQV 94
            ||...| .:.:.:|||||:|.||:||.|:|:|..        .|:|::.::.:|.:||.|:||..
 Frog   158 PKEWDNEPLQVFVVPHSHNDPGWIKTFDKYYYDQ--------TQHILNNMVVKLHEDPRRKFIWS 214

  Fly    95 ETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFG 159
            |.|||:|||...:...:..||:||..|:||.|.|.|.|.|||..:|.::|||...|.::|.....
 Frog   215 EISFFSKWWDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLD 279

  Fly   160 SCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSND 223
              |.||.||.:||||||.....|..:.........|:.:..|........:|.:|..: |..|:.
 Frog   280 --ATPRSGWAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSST 342

  Fly   224 EIFTGLLYRHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRV 265
            :||..::       |.|.:|| | ||.||.|    |.:..                 |:||..|.
 Frog   343 DIFCHMM-------PFYSYDVPHTCGPDPKICCQFDFRRLPGGRINCPWKVPPRAITDSNVAERA 400

  Fly   266 DDFLSYVTSVAQHYRSNHIMIPMGDDFQYE-----DAQVNFKNMDKLIKYVNER-----QAEGST 320
            :..|......::.|||..:::|:||||:|:     |||  |.|..||..|:|..     ||:   
 Frog   401 NILLDQYKKKSKLYRSKVVLVPLGDDFRYDKIQEWDAQ--FLNYQKLFDYMNSHPELHVQAQ--- 460

  Fly   321 FNLFYSTPACYLNSLHE------GLQ--TWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDG 377
                :.|.:.|.::|::      |::  .:|..:.|||.|...::.|||||:||||..|..:|..
 Frog   461 ----FGTLSDYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVL 521

  Fly   378 NHILQVAKQLSVFAELNTKQQKEDLEY----------LREIMGVMQHHDAITGTEKQHVSDDYDR 432
            ...|:.|:.|...|..:.::...:.:|          .|..:|:.|||||||||.|:.|..||  
 Frog   522 ESHLRGAEILYSLAINHARKAGTESKYPLSDYALLTDARRNLGLFQHHDAITGTAKEAVVIDY-- 584

  Fly   433 ILYDAILGGVNTARDGLRKLTNLPN-----------------------------GEFESCL-QLN 467
                           |:|.|.:|.|                             ...||.| |.:
 Frog   585 ---------------GVRLLHSLMNLKRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQES 634

  Fly   468 ISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEF 532
            :.|....|..|....|.::||:.......|.:.|...|..|..|.|:.||:::.|| ||  ::..
 Frog   635 LPEKTVIKLTASPRYVVVFNPVEQNRLCVVSLLVNTYNVRVLTEDGQPVAAQLSPV-WQ--SVTD 696

  Fly   533 RNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKN 597
            .|.|. :::.|.|.:..:.....:..||.:|     ||..|.:::......|:..:.:.|..:|.
 Frog   697 MNPDV-YQVSFTARLPSLGLSIFQLHASIDT-----HTTLKSNVRVHLHGRELSIKKQDVFPVKV 755

  Fly   598 ATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNG--VSENIDQSYGVYRTY----DSGAYVF 656
            |..:.||..    ::...:::.....|||||:::..|  ..:.|:..:.:|.|.    .||||:|
 Frog   756 AESSTDDFH----IENQYMQVWFSGTTGLLKSIKRAGEEQEQKINMQFLIYGTRTSKDKSGAYLF 816

  Fly   657 RQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIY-----EGKNLVEIEWQVGPIER 716
            ....:|......:.....|.:|....||..|: :::.||:|:|     ||.:| :|.   ..|:.
 Frog   817 LPDGEAKPYTPKDPPVVKVTEGPFYSEVTCQY-QHVQQVMRLYNLPGTEGLSL-DIS---SLIDI 876

  Fly   717 EEEFGREVVIIFNSTIASDGVSYTDSNG 744
            .:...:|:.:..::.|.|:.:.:||.||
 Frog   877 RDHVNKEIAMRLSTDIQSEDIFFTDLNG 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 101/303 (33%)
Alpha-mann_mid 359..434 CDD:286360 31/85 (36%)
Glyco_hydro_38C 482..1002 CDD:285047 67/275 (24%)
man2a2NP_001006777.1 PLN02701 128..>906 CDD:178304 226/809 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.