DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and alpha-Man-IIb

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001262614.1 Gene:alpha-Man-IIb FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster

Alignment Length:1146 Identity:277/1147 (24%)
Similarity:468/1147 (41%) Gaps:230/1147 (20%)


  Fly    27 YEACPKTKTN-MINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARR 90
            ::|..|.|.. .:.|.:|||||:|.|||||...||        .:..:.|::.::.::.:.....
  Fly   156 FDAQKKDKQRPPLKIIVVPHSHNDPGWLKTFTNYF--------QSDSRQILNLLVTKMQEYTDMT 212

  Fly    91 FIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLD 155
            ||..|.||...||.:...|.::.:::|::.||:|.|.|.|.|.|||.|:...::||...|.::|.
  Fly   213 FIWSEISFLQLWWDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLK 277

  Fly   156 DTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DS 219
            :...  ..|::||.||||||......:.:...::|....|:.:..|.........:.||... .|
  Fly   278 NNLN--VTPKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRS 340

  Fly   220 LSNDEIFTGLLYRHYSAPPGYCFDVH-----CGDDPII-----------DTKSY--------DNN 260
            ..:.:...|.|..| :.|    ||::     ||..|.|           :...|        |:|
  Fly   341 RKDKDSEAGSLLTH-NMP----FDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDN 400

  Fly   261 VKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQY-EDAQVN--FKNMDKLIKYVNERQAEGSTFN 322
            ::|:....|......|..:..|..:||:||||:| :|.:|:  ::|..|||.::   .|....:|
  Fly   401 LESKAQLLLEQYARTASLFPHNVALIPVGDDFRYNKDREVDQQYQNYKKLIDHI---MANRRLYN 462

  Fly   323 --LFYSTPACYLNSLHEGLQT----WPNKTQDFFPYGSDDNS-----YWTGYFTSRPTQKRFERD 376
              :.:.||:.|..::.|.::.    :|....|||.| ||..|     ||:||||:||..|....:
  Fly   463 ADIRFGTPSDYFEAIKERMKDHTPGFPTFKGDFFVY-SDIFSEGRPAYWSGYFTTRPFYKLLSSE 526

  Fly   377 GNHILQVAKQLSVFAELNTKQQKED------------LEYLREIMGVMQHHDAITGTEKQHVSDD 429
            ..|.|:.|:.:...|....:|.|.:            :...|..:|:.|||||||||.|..|..|
  Fly   527 LEHQLRSAEIVFTLAYNTARQAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRD 591

  Fly   430 YDRILYDAILGGVNT------------------------ARDGLRKL-----TNLPNGEFESCLQ 465
            |...|:::....|..                        .||...||     ..:.||: ||...
  Fly   592 YAMRLFESTQNMVKMQESCLELLLQKGQPRHHGFLLSEFERDNFNKLPRKMPIQMANGD-ESTPT 655

  Fly   466 LNISECAFTKDDADNVV--VTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVL 528
            :...|.......:...|  ..|||.||....:.|.:.|::.|.::.::||..:....:...|.:.
  Fly   656 VPAGEGGAGGSSSSGSVGSFVLYNSLAQKRLEVVTLRVQHPNVKIVNDKGVELNHIQINPVWNIT 720

  Fly   529 AL--------------EFRNNDTQHELVFKASVDKIA-NYYIKKVASQETKNVAAHTKSKRSIKA 578
            ..              ..|.:..|.|::|.|.::.:: :.|..:|.....|...|........::
  Fly   721 DTYEQGLGTSVSGTVGRIRTSTRQFEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTES 785

  Fly   579 EEANLEVPKRFKKVHSLKNATETFD---DDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENI- 639
            :.|::..|:..:     .:.|..|:   ...|:..::...::|:.|.|:|.|||:......:.: 
  Fly   786 QPASVSPPEEIE-----SSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELL 845

  Fly   640 -----DQSYGVYRT--YDSGAYVFR-----QYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYI 692
                 :..:..||:  :.||||:|:     ...:.:.:..|..:...:..|.:..:|...:..::
  Fly   846 KPLQCNIKFAAYRSAQFHSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFL 910

  Fly   693 SQVIRIYEGKNLV--------EIEWQVGPIEREEE-FGREVVIIFN-----------------ST 731
            :..:||:..:..:        :|:::..|..||.| |.|.|..|.|                 :|
  Fly   911 AHTVRIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAAT 975

  Fly   732 IASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQG 796
            :....|.|:|.||.:..:|:|      .|.:..:   .||:|:||...:|||:.|:.:|...|||
  Fly   976 MPELPVFYSDQNGFQYHERIK------VPAIGIE---GNYFPITSGAFIQDSRLRLTLLTTHAQG 1031

  Fly   797 GASMLNGQLELMLHRRLVRDDGYGVGEA-------------LNEEKYGQPMIARGKVYLILSPSD 848
            .||...||||:||.||.:.||..|:||.             |.|:..|...:.:...|.:||...
  Fly  1032 AASYEPGQLEVMLDRRTLYDDYRGMGEGVVDSRLTRHKFWLLVEDLPGGQHVTQPPSYKVLSQQA 1096

  Fly   849 ESTAAEREAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFNDFPK-----SVHLLTLEPFNDDEVLL 908
            :..|      ..:..|...:|..|......||..:|.....||     .|||.||...:|.|:.|
  Fly  1097 QQLA------NALRYPPNLYFVSNLEQPELAAALLPLVRLLPKGPLPCDVHLTTLRTLSDPELQL 1155

  Fly   909 ---RVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLS-------DMKRFKFHHDSSG 963
               .....:.|.:|...|.:..           ||.:::...|||       .:.|...|     
  Fly  1156 FPSASALLVLHRQGFDCSVSAG-----------RELSMEAICPLSSKGLGNVQLGRLSLH----- 1204

  Fly   964 QKPDAVE--YFTSAHKPLAAEQSQEASEFSVTLHPMQIRTF 1002
                .:|  ..|...:..:.|.....|...::|.||::|||
  Fly  1205 ----TIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTF 1241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 84/302 (28%)
Alpha-mann_mid 359..434 CDD:286360 30/87 (34%)
Glyco_hydro_38C 482..1002 CDD:285047 134/609 (22%)
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 277/1147 (24%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 102/366 (28%)
Alpha-mann_mid 508..596 CDD:286360 30/88 (34%)
Glyco_hydro_38C 813..1241 CDD:285047 108/463 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64909923
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.