DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and MAN2B1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_005259970.1 Gene:MAN2B1 HGNCID:6826 Length:1012 Species:Homo sapiens

Alignment Length:1049 Identity:417/1050 (40%)
Similarity:591/1050 (56%) Gaps:122/1050 (12%)


  Fly     4 LCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQ 68
            ||   .|:.|||.:   ...|.|||.||..:.||:|:|::||:||||||||||||||||.:::||
Human    35 LC---FFLLLLAAA---GARAGGYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQ 93

  Fly    69 HAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMN 133
            |||||||:|:||:.|:.||.||||.||.:||::||.:|:...::|||.||.:|||||..|.|.||
Human    94 HAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMN 158

  Fly   134 DEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDH 198
            ||||.:|.:::||.||||:||:||||:..|||:.|.||||||||||||:|||||:||.||.|:|:
Human   159 DEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDY 223

  Fly   199 RDKNDRIDNLGMEMIWDASDSLS--NDEIFTGLLYRHYSAPPGYCFDVHCGDDPII-DTKSYDNN 260
            :||..|:..|.||.:|.||.||.  ..::|||:|...|:.|...|:||.|.|.|:: |.:|.:.|
Human   224 QDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYN 288

  Fly   261 VKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVN-ERQAEGSTFNLF 324
            .|..||.||:..|:..::||:||.::.||.|||||:|.:.|||:||||:.|| ::||:||:.::.
Human   289 AKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQQAKGSSVHVL 353

  Fly   325 YSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSV 389
            ||||||||..|::...||..|..|||||....:.:|||||:|||..||:||...:.|||..||..
Human   354 YSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEA 418

  Fly   390 FAELNTK---QQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRIL------YDAILGGVNTA 445
            ...|...   ....|...|.|.|.|:|||||::||.:|||::||.|.|      .:.:|.     
Human   419 LVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLS----- 478

  Fly   446 RDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTD 510
             :.|.:|....: .|..|.|||||.|..:: .|....|.:||||.......||:||....:.|.|
Human   479 -NALARLRGFKD-HFTFCQQLNISICPLSQ-TAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKD 540

  Fly   511 EKGRVVASEVVPVAWQVLALEFRNNDTQ-H--ELVFKASVDKIANYYIKKVASQETKNVAAHTKS 572
            ..||.|.|:||         .|.::|:| |  ||:|.||:..:         ...|.:||...:.
Human   541 PNGRTVPSDVV---------IFPSSDSQAHPPELLFSASLPAL---------GFSTYSVAQVPRW 587

  Fly   573 KRSIKAEEANLEVPKR-FKKVHSLKN--ATETFDDDEG---ETVVQTSQVKLVI----------- 620
            |...:|.:   .:|:| :....:::|  ...|||.|.|   |.:....|:.|.:           
Human   588 KPQARAPQ---PIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASI 649

  Fly   621 -DNKTGLLKTVEMNGVSENIDQSYGVYRTYDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEV 684
             ||::               ||:        ||||:||...|....|. ...:..:....||:||
Human   650 GDNES---------------DQA--------SGAYIFRPNQQKPLPVS-RWAQIHLVKTPLVQEV 690

  Fly   685 HQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIK 749
            ||.||.:.|||:|:|.|:..:|:||.||||...:.:|:||:..|::.:.:.|..||||||||:::
Human   691 HQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILE 755

  Fly   750 RVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLV 814
            |.:|.|.|:... ..:|.|.|||||.:||.:.|...::.||.||:|||:|:.:|.||||:||||:
Human   756 RRRDYRPTWKLN-QTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLL 819

  Fly   815 RDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAER-EAEKEIHLPFWKFFSKNTGSTTA 878
            :|||.||.|.|.|.  |.....||:..::|..:..:.|..| .||:|:..|..........:...
Human   820 KDDGRGVSEPLMEN--GSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNL 882

  Fly   879 AAKSVPSFN----DFPKSVHLLTLEPFNDDEVLLRVEN--FLDHTEGQ----VVSFNIRPIFDYL 933
            .|.....|:    |.|.|||||||..:..:.||||:|:  .:....|:    .|:.|:|.:|...
Human   883 GAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTF 947

  Fly   934 NGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQ 998
            ....::||||..|.......|.|: ..::|..|....|              :....::||.||:
Human   948 TITRLQETTLVANQLREAASRLKW-TTNTGPTPHQTPY--------------QLDPANITLEPME 997

  Fly   999 IRTFIIKTE 1007
            ||||:...:
Human   998 IRTFLASVQ 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 156/277 (56%)
Alpha-mann_mid 359..434 CDD:286360 36/78 (46%)
Glyco_hydro_38C 482..1002 CDD:285047 175/552 (32%)
MAN2B1XP_005259970.1 PLN02701 63..1001 CDD:178304 402/1009 (40%)
GH38N_AMII_LAM_like 63..341 CDD:212121 157/278 (56%)
Alpha-mann_mid 388..466 CDD:214875 36/78 (46%)
Glyco_hydro_38C 511..1001 CDD:285047 175/553 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64883318
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T609335
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.