DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and MAN2A1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_002363.2 Gene:MAN2A1 HGNCID:6824 Length:1144 Species:Homo sapiens

Alignment Length:1094 Identity:293/1095 (27%)
Similarity:473/1095 (43%) Gaps:237/1095 (22%)


  Fly    35 TNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFF 99
            |..:.:.:|||||:|.|||||.:.||        ....|||.:.::.:|.:|..|:||..|.|:.
Human   163 TEPLQVFVVPHSHNDPGWLKTFNDYF--------RDKTQYIFNNMVLKLKEDSRRKFIWSEISYL 219

  Fly   100 AKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARP 164
            :|||.......|..|:.|:..|:||...|.|.|.|||..:|.::|||...|.::|::..|  .:|
Human   220 SKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIG--VKP 282

  Fly   165 RIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSNDEIFTG 228
            |.||.|||||||...|.:..:.|.......|:.:..|.....:..:|..|..: |..|..:|...
Human   283 RSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCH 347

  Fly   229 LLYRHYSAPPGYCFDV-H-CGDDPII----DTKS-----------------YDNNVKSRVDDFLS 270
            ::       |.|.:|: | ||.||.|    |.|.                 :..||:||....|.
Human   348 MM-------PFYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLD 405

  Fly   271 YVTSVAQHYRSNHIMIPMGDDF---QYEDAQVNFKNMDKLIKYVNERQAEGSTF--NLFYSTPAC 330
            .....::.:|:..::.|:||||   :|.:..:.|||..:|..|:|.:    |.|  .:.:.|.:.
Human   406 QYRKKSKLFRTKVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQ----SKFKVKIQFGTLSD 466

  Fly   331 YLNSLHEGLQTWPNKTQ--------DFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQL 387
            :.::|.:..:|..:|.|        |||.|...|:.||:|||||||..||.:|.....|:.|:.|
Human   467 FFDALDKADETQRDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEIL 531

  Fly   388 SVFAELNTKQQKED----------LEYLREIMGVMQHHDAITGTEKQHVSDDYDRILY------D 436
            ..||.....:.|.:          |...|..:|:.|||||||||.|..|..||...|:      :
Human   532 YYFALRQAHKYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLE 596

  Fly   437 AILGGVNTA-----RDGLRKLT------------NLPNGEFESCLQLNISECAFTKDDADNVVVT 484
            .|:|  |:|     :|   |||            :|.....:|..|.||...:     |:...:.
Human   597 KIIG--NSAFLLILKD---KLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLS-----AEPRYLV 651

  Fly   485 LYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNN---DTQHELVFKAS 546
            :||||.......|.|.|.:...:|....|:       ||..||.|:....|   :|.:|:.|:|.
Human   652 VYNPLEQDRISLVSVYVSSPTVQVFSASGK-------PVEVQVSAVWDTANTISETAYEISFRAH 709

  Fly   547 VDKIA--NYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGET 609
            :..:.  .|.|.:.||..: ::|.:...|.  |.|::.         :.::||...|   :||.|
Human   710 IPPLGLKVYKILESASSNS-HLADYVLYKN--KVEDSG---------IFTIKNMINT---EEGIT 759

  Fly   610 VVQTSQVKLVIDNKTGLLKTV--EMNGVSENIDQSYGVYRTY----DSGAYVFRQYHQADFIVQY 668
             ::.|.|.|..| :|||:|.:  :.:|....::..:..|.|.    .||||:|.....|...|..
Human   760 -LENSFVLLRFD-QTGLMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYT 822

  Fly   669 EGVEFTVYDGALVKEVHQQFSEYISQVIRIY-----EGK-----NLVEIEWQVGPIEREEEFGRE 723
            ......|..|.:..|| ..|.::::..:|:|     ||:     |:|:|         .:.:.||
Human   823 TPPFVRVTHGRIYSEV-TCFFDHVTHRVRLYHIQGIEGQSVEVSNIVDI---------RKVYNRE 877

  Fly   724 VVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIA 788
            :.:..:|.|.|....|||.||.::..|:.         |.:.|..||.||:|:...:||:|.|:.
Human   878 IAMKISSDIKSQNRFYTDLNGYQIQPRMT---------LSKLPLQANVYPMTTMAYIQDAKHRLT 933

  Fly   789 VLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAA 853
            :|:.::.|.:|:.:||:|:::.|||::||..|:.:.:.:.|      ....::.||  .::.:|.
Human   934 LLSAQSLGVSSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNK------ITANLFRIL--LEKRSAV 990

  Fly   854 EREAEKEI----------------H--LPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLEP 900
            ..|.||:.                |  :|....||..|  .....:..|..:..|..:||:.|..
Human   991 NTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKFSSPT--LELQGEFSPLQSSLPCDIHLVNLRT 1053

  Fly   901 F---------NDDEVLLRVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFK 956
            .         |:..::|       |.:|....|:.:       |..:..:|..|.:.:..:.. |
Human  1054 IQSKVGNGHSNEAALIL-------HRKGFDCRFSSK-------GTGLFCSTTQGKILVQKLLN-K 1103

  Fly   957 FHHDSSGQKPDAVEYFTSA-----HKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            |          .||..|.:     |.|...:...|     :.|.||:|.||.|:
Human  1104 F----------IVESLTPSSLSLMHSPPGTQNISE-----INLSPMEISTFRIQ 1142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 93/301 (31%)
Alpha-mann_mid 359..434 CDD:286360 34/85 (40%)
Glyco_hydro_38C 482..1002 CDD:285047 135/573 (24%)
MAN2A1NP_002363.2 PLN02701 128..1144 CDD:178304 293/1095 (27%)
GH38N_Man2A1 165..508 CDD:212131 110/364 (30%)
Alpha-mann_mid 503..588 CDD:214875 34/85 (40%)
Glyco_hydro_38C 754..1139 CDD:285047 106/449 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.