DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and MAN2A2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001307906.1 Gene:MAN2A2 HGNCID:6825 Length:1175 Species:Homo sapiens

Alignment Length:1135 Identity:296/1136 (26%)
Similarity:464/1136 (41%) Gaps:294/1136 (26%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.||:||.|:|:...        .|:|:::::::|.:||.|||:..|.||||||
Human   166 LQVFVVPHSHNDPGWIKTFDKYYTEQ--------TQHILNSMVSKLQEDPRRRFLWAEVSFFAKW 222

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |...:...:..||:||..|:||...|.|.|.|||..:|.::|||...|.::|:...|  |.||.|
Human   223 WDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLG--ATPRSG 285

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSNDEIFTGLLY 231
            |.:||||:|.....:..:.........|:.:..|........:|.:|..: ||.|:.:||..:: 
Human   286 WAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMM- 349

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|| | ||.||.|    |.|..                 :.||..|....|....
Human   350 ------PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYR 408

  Fly   274 SVAQHYRSNHIMIPMGDDFQYE-----DAQVNFKNMDKLIKYVNER-----QAEGSTFNLFYSTP 328
            ..:|.:|||.:::|:||||:|:     |||  |.|..:|..:.|.|     ||:       :.|.
Human   409 KKSQLFRSNVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFFNSRPNLHVQAQ-------FGTL 464

  Fly   329 ACYLNSLHE--GLQT------WPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAK 385
            :.|.::|::  |::.      :|..:.|||.|...::.|||||:||||..|..:|.....|:.|:
Human   465 SDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAE 529

  Fly   386 QLSVFAELNTKQQ-------KEDLEYL---REIMGVMQHHDAITGTEKQHVSDDYDRILYDAILG 440
            .|...|..:.::.       ..|...|   |..:|:.|||||||||.|:.|..||          
Human   530 VLYSLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDY---------- 584

  Fly   441 GVNTARDGLRKLTNL----------------------PNGEFESCLQLNISECAFTKD------- 476
            ||..    ||.|.||                      |...|     |.:.:...:.|       
Human   585 GVRL----LRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPF-----LQVDDTRLSHDALPERTV 640

  Fly   477 ---DADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVV----------ASEVVPVAWQVL 528
               |:....|.|:|||.......|.:.|.:....|..|:|:.:          |:|.||..:||.
Human   641 IQLDSSPRFVVLFNPLEQERFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVS 705

  Fly   529 ------ALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPK 587
                  ||.......|..|....::......|:             |.: :.|:...||   .|.
Human   706 VPVRLPALGLGVLQLQLGLDGHRTLPSSVRIYL-------------HGR-QLSVSRHEA---FPL 753

  Fly   588 RFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQS-------YGV 645
            |            ..|....:..:....:::.....|||||::..  |.|..:|.       ||.
Human   754 R------------VIDSGTSDFALSNRYMQVWFSGLTGLLKSIRR--VDEEHEQQVDMQVLVYGT 804

  Fly   646 YRTYD-SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIY-----EG--- 701
            ..:.| ||||:|....:|...|..|.....|.:|....|| ..:.|:|.|.:|:|     ||   
Human   805 RTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEV-VAYYEHIHQAVRLYNLPGVEGLSL 868

  Fly   702 --KNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDR 764
              .:||:|         .:...:|:.:..::.|.|.|:.:||.||.:    |:.:|.     |.:
Human   869 DISSLVDI---------RDYVNKELALHIHTDIDSQGIFFTDLNGFQ----VQPRRY-----LKK 915

  Fly   765 QPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEK 829
            .|..||:||:.....:||::||:.:...:|.|.:|:.:||||::|.|||::||..|:|:.|.:.|
Human   916 LPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLKDNK 980

  Fly   830 Y---------------GQP-------MIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSKN 872
            .               .:|       .:.||.::      ..|.:..||.:......:....|..
Human   981 RTCNRFRLLLERRTVGSEPDFFSKLAAMFRGLIF------HSSRSGNREVQDSHSTSYPSLLSHL 1039

  Fly   873 TGS-TTAAAKSVP------------SF----NDFPKSVHLLTLEPFNDDE---------VLLRVE 911
            |.. ..|.|.::|            ||    :..|...|||.|.....:|         ::|..:
Human  1040 TSMYLNAPALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRK 1104

  Fly   912 NFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHH-DSSGQKPDAVEYFTSA 975
            .|....|.:.:.||.              ||..|.:.|..:    ||. |....:|.::...   
Human  1105 GFDCGLEAKNLGFNC--------------TTSQGKVALGSL----FHGLDVVFLQPTSLTLL--- 1148

  Fly   976 HKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
             .|||:    .::...|.|.||:|.||.::
Human  1149 -YPLAS----PSNSTDVYLEPMEIATFRLR 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 99/303 (33%)
Alpha-mann_mid 359..434 CDD:286360 32/85 (38%)
Glyco_hydro_38C 482..1002 CDD:285047 139/603 (23%)
MAN2A2NP_001307906.1 PLN02701 136..1174 CDD:178304 296/1136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.