DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2b1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_017456800.1 Gene:Man2b1 RGDID:3039 Length:1046 Species:Rattus norvegicus

Alignment Length:1006 Identity:403/1007 (40%)
Similarity:567/1007 (56%) Gaps:103/1007 (10%)


  Fly     8 VLFVALL--AISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYG---H---- 63
            ||.::.|  .:...|..:|.||:.||.||..|:|:|::||:|||||||||||||:||   |    
  Rat    31 VLSISFLIWLLLAAPGAQAAGYKTCPTTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDPHLLTF 95

  Fly    64 ----RSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLE 124
                .|::|||.||||:|:||..|:.||.||||.||.:||::||.:|:...:..||.||.:||||
  Rat    96 MPIVMSDVQHASVQYILDSVIYSLLNDPTRRFIYVEMAFFSRWWKQQTNVTQDAVRNLVRQGRLE 160

  Fly   125 FTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYD 189
            |..|.|.||||||.:|.:::||.||||:||.|||||...||:.|.||||||||||||:|||||:|
  Rat   161 FVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFD 225

  Fly   190 GEFFARMDHRDKNDRIDNLGMEMIWDASDSLSND--EIFTGLLYRHYSAPPGYCFDVHCGDDPII 252
            |.|..|:|::||.:|...|.||.:|.||.||...  ::|||:|..:|:.|...|:||.|.|.|::
  Rat   226 GFFLGRIDYQDKFNRKRKLKMEELWRASASLKPPAADLFTGVLPNNYNPPKDLCWDVLCTDPPVV 290

  Fly   253 -DTKSYDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNE-RQ 315
             |..|.:.|....||.||:..:|..::||:||.::.||.|||||:|.:.||||||||:.||| :|
  Rat   291 DDPTSPEFNANKLVDYFLNLASSQKKYYRTNHTVMTMGSDFQYENANMWFKNMDKLIRLVNEQQQ 355

  Fly   316 AEGSTFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHI 380
            |.||..::.||||:|||..|::...||..|..|||||....:.:|||||:|||..||:||...:.
  Rat   356 ANGSKVHVLYSTPSCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNF 420

  Fly   381 LQVAKQLSVFAELNTK---QQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDA----- 437
            |||..||........|   ....|...|.|.|.|:|||||:|||.:|:|.:||.:.|...     
  Rat   421 LQVCNQLEALVGPEAKVGPYGSGDSAPLNEAMAVLQHHDAVTGTARQNVVNDYAKQLAAGWGPCE 485

  Fly   438 ILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVK 502
            :|.....||..|.|      ..|..|.::|||.|. ....:::..|.:|||:.......||:||.
  Rat   486 VLVSNALARLSLYK------QNFSFCREINISICP-ASQTSEHFRVIIYNPVGRKVDLMVRLPVS 543

  Fly   503 NENYEVTDEKGRVVASEV--VPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKN 565
            ...:.|.|...|.::|.|  ||.|:        :...|.||:|.|||..: .:.|..|......|
  Rat   544 EGIFLVKDPNDRRISSNVVMVPSAY--------SKTYQWELLFPASVPAL-GFSIYSVNKMSGHN 599

  Fly   566 VAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTV 630
            ..||..:.|..|::...|                          |::...::...|:.||||:.:
  Rat   600 HQAHNLTARPKKSKSRVL--------------------------VIENKYIRATFDSDTGLLRKI 638

  Fly   631 EMNGVSENID----QSYGVYRT--------YDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKE 683
            |  .:.:||.    |.:..|..        ..||||:||..|:....|.: ..:.|:....||:|
  Rat   639 E--NLEQNISLPVRQGFFWYNASAGDEESPQASGAYIFRPSHRKPLPVSH-WAQVTLVKTNLVQE 700

  Fly   684 VHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMI 748
            |||.||.:.|||||:|||:..:|:||.||||..::::|:||:..||:.:.:.|..:|||||||::
  Rat   701 VHQNFSAWCSQVIRLYEGQRHLELEWTVGPIPVKDDWGKEVISRFNTPMRTRGQFFTDSNGREIL 765

  Fly   749 KRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRL 813
            ||..|.|.|:|.. ..:|.|.|||||.:||.:.|...::.||.||:|||:|:|:|.||||:||||
  Rat   766 KRRDDFRPTWTLN-QTEPVAGNYYPVNTRIYITDGHMQLTVLTDRSQGGSSLLDGSLELMVHRRL 829

  Fly   814 VRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAER-EAEKEIHLPFWKFFSKNTGSTT 877
            :.||..||.|.|.|...|..:  ||:..:|||...::.|..| .||:|:..|  :....:.||:.
  Rat   830 LVDDERGVAEPLLETDTGDKV--RGRHLVILSSVSDAAARHRLLAEQEVLAP--QVVLAHGGSSP 890

  Fly   878 AAAKSVPSF------NDFPKSVHLLTLEPFNDDEVLLRVENFLDHTE------GQVVSFNIRPIF 930
            ..::: |..      .:.|..||||||..:....:|||:|:.....|      ...|:.|::.:|
  Rat   891 YHSQA-PKMQFSALRRELPPQVHLLTLARWGPKMLLLRLEHQFAVKEDSNRNLSSPVTLNLQNLF 954

  Fly   931 DYLNGVEIRETTLDGNLPLSDMKRFKFHHDS 961
            .......::||||..|.|||.:.|.|:..|:
  Rat   955 KTFTINYLQETTLAANQPLSRVSRLKWMTDT 985

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 153/288 (53%)
Alpha-mann_mid 359..434 CDD:286360 35/78 (45%)
Glyco_hydro_38C 482..1002 CDD:285047 169/508 (33%)
Man2b1XP_017456800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64849975
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 809 1.000 Inparanoid score I450
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T618275
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.