DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2b2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001128443.1 Gene:Man2b2 RGDID:1308840 Length:1004 Species:Rattus norvegicus

Alignment Length:1135 Identity:303/1136 (27%)
Similarity:467/1136 (41%) Gaps:277/1136 (24%)


  Fly     4 LCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQ 68
            |.|.:|.  |..::.||        |.|      |...:|||||.||||:.||.:....:.:|  
  Rat     9 LLGQLLL--LWPLAARP--------ASP------IRAFVVPHSHMDVGWVYTVQESMRAYAAN-- 55

  Fly    69 HAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWW-AEQSETAKQVVRKLVNEGRLEFTGGAWSM 132
                  :..||:.||::...||||.||..||..|| ...||..||.||:|::||.|||..|...|
  Rat    56 ------VYTTVVEELVRGRQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLDEGCLEFVLGGQVM 114

  Fly   133 NDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMD 197
            :|||..:....|.|.|.|..||.:|||  .||:..|.:||||.|....::|:..|::....:|:|
  Rat   115 HDEAVTHLDDQILQLTEGHGFLYETFG--IRPQFSWHVDPFGASATTPTLFSLAGFNAHLISRID 177

  Fly   198 HRDKNDRIDNLGMEMIWDASDSLS-NDEIFTGL--LYRHYSAPPGYCFDVHCG------------ 247
            :..|:...:..|::.:|..|.||| ..||:|.:  || .|..|....|....|            
  Rat   178 YDLKDAMQEAQGLQFVWHGSPSLSEQQEIYTHVMDLY-SYCTPSHIPFSNRSGFYWNGVAVFPEP 241

  Fly   248 ---------DDPIIDTKSYDN----------NVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQ 293
                     .:|:    :.||          |:|.|           |..:|:.|::.|.|.|.|
  Rat   242 PPDGVYPNMSEPV----TVDNIHLYAEALVANIKQR-----------AAWFRTPHVLWPWGCDKQ 291

  Fly   294 YEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNKT-QDFFPYGSDDN 357
            :.:|.|.|.|||.|::|:|.|.|:.. .::.|:|...|..:||:...||..:. .||.||.|:..
  Rat   292 FFNASVQFDNMDPLLEYINNRSAQFG-ISVQYATLNDYFQALHDFNVTWDIRDHHDFLPYSSEPQ 355

  Fly   358 SYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE---------LNTKQQKEDLEYLREIMGVMQ 413
            ..|||::|||.|.|...|..:.:|...:  |:|..         |:.....:.|:.||..:..:|
  Rat   356 QAWTGFYTSRSTLKGLARQASALLYAGE--SMFTRYMWPHPRGTLDPTWALQQLQQLRWAVSEVQ 418

  Fly   414 HHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDA 478
            |||||||||...|.:.|        :..::....|:.||.        :.:.|:.|..:.|....
  Rat   419 HHDAITGTESPKVKNMY--------MEHLSMGMRGVHKLM--------ASIALDRSPGSGTDTRP 467

  Fly   479 DNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQ----H 539
            .....::|||||...|..:.:.|...:..||||.||.|::::             .|.|:    :
  Rat   468 VGYSASVYNPLAWKITTIITLTVAFPSVSVTDELGRPVSAQI-------------QNSTKDPSAY 519

  Fly   540 ELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDD 604
            :|:...::..::..|.|      .:.:.......|.:....||     ..|....|:|.|    .
  Rat   520 DLLILTTIPGLSYRYYK------VRRILGDQAGTRELVTPRAN-----TLKFSRKLRNQT----S 569

  Fly   605 DEGETVVQTSQ--VKLVIDNKTGLLKTVE--MNGVSENIDQSYGVYRTYD-------SGAYVFRQ 658
            .||:.:|....  ..|:.|..|.:|.:::  .:..:.::.|.:..||...       |..|:|..
  Rat   570 QEGKLLVPVMNDCYTLLFDQDTNMLHSIQDRQSNRTVHMTQEFLEYRANGDVKQGPISDNYLFAS 634

  Fly   659 YHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYE-------------GKNL---VEI 707
            ...|:...:..|:|..|  |.|..:|.|.|...|:....||.             |:.|   :|.
  Rat   635 NDTAEPSWEAVGMEMVV--GTLATDVRQYFYRNITDQGYIYSIHTRLAHVHPSLAGELLCRRIEQ 697

  Fly   708 EWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYY 772
            ::||||:    :..||.::..:|.:.|..|.|:|:||.:|      ||..: ......|...|||
  Rat   698 QYQVGPL----DLNREAILRTSSDLNSQQVLYSDNNGYQM------QRRPY-KAFKSNPIPRNYY 751

  Fly   773 PVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRR----LVRDDGYGVGEALNEEKYGQP 833
            |:.....::|.|.|:.:|.:|..|.:|..|||:|:|||||    ||.|..|.:  .||:.....|
  Rat   752 PMVQSAFIEDDKSRLVLLAERPHGVSSQENGQVEVMLHRRLWNNLVWDLNYNL--TLNDTSVVHP 814

  Fly   834 MIARGKVYLILSPSDESTAAE-------------------REAEKEIHLPF--WKFFSKNTGSTT 877
            ::     :|:|.|...:||..                   .|.|..||.|.  |..         
  Rat   815 VL-----WLLLGPKSTTTALRPRSGVALQHRPVVLLKELTDEEETAIHRPHHPWPV--------- 865

  Fly   878 AAAKSVPSFNDFPKSVHLLTLE-------------------------PFNDDEVLLRVENFLDHT 917
                      ..|.|:||..|.                         ..|...||||:.:..:..
  Rat   866 ----------TLPPSLHLQVLSLRGWQYSRNHAQHLKNLQRGHPEKPQVNLQRVLLRLHHLYEAG 920

  Fly   918 EGQVVSFNIRP----IFDYLNG----VEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTS 974
            |..|:|   ||    :...|.|    |.:.|.:|.|...:..::|:.: ....||        ..
  Rat   921 EDPVLS---RPATVDLKIALRGLGSVVAVEERSLTGTWDVQTLQRWHW-RTKIGQ--------LK 973

  Fly   975 AHKPLAAEQSQEASEFSVTLHPMQIRTFII 1004
            .| |.:..:|...|  .:|::|.:||||.|
  Rat   974 GH-PTSPPRSPGGS--IITVYPKEIRTFFI 1000

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 102/309 (33%)
Alpha-mann_mid 359..434 CDD:286360 28/84 (33%)
Glyco_hydro_38C 482..1002 CDD:285047 142/609 (23%)
Man2b2NP_001128443.1 GH38N_AMII_Epman_like 27..352 CDD:212122 116/352 (33%)
Alpha-mann_mid 358..439 CDD:214875 28/91 (31%)
Glyco_hydro_38C 474..998 CDD:285047 142/606 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.