DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and LManII

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_609408.1 Gene:LManII FlyBaseID:FBgn0027611 Length:1080 Species:Drosophila melanogaster

Alignment Length:1107 Identity:486/1108 (44%)
Similarity:670/1108 (60%) Gaps:149/1108 (13%)


  Fly     7 IVLFVALLAI-------SVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHR 64
            :|.|.||..:       |::|....|||::|..||.||:|:|:|.|:|||||||||||||:||..
  Fly     9 LVFFCALGCLIHDADLRSIQPKASQCGYQSCHPTKPNMLNVHLVAHTHDDVGWLKTVDQYYYGSE 73

  Fly    65 SNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGA 129
            :.||.||||||||:|:..|::||.:|||.||::||.|||.||....::.|:.||.:|||||.|||
  Fly    74 TKIQKAGVQYIIDSVVEALLRDPEKRFIYVESAFFFKWWKEQKPKVQEAVKMLVEQGRLEFIGGA 138

  Fly   130 WSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFA 194
            |||||||..:||||||||:.||:.|:||||.|.|||:||||||||||||.||:|||||:||.||.
  Fly   139 WSMNDEATTHYQSVIDQFSWGLRLLNDTFGECGRPRVGWQIDPFGHSREMASMFAQMGFDGMFFG 203

  Fly   195 RMDHRDKNDRIDNLGMEMIWDASDSLSND-EIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTK-SY 257
            |:|::||::|:.....||||..|.:|..: ::|:|.||.:|.||.|:|||:.|.|.||||.| |.
  Fly   204 RLDYQDKDERLMTKNAEMIWHGSANLGEEADLFSGALYNNYQAPDGFCFDILCNDAPIIDGKHSP 268

  Fly   258 DNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFN 322
            |||||.|:|.||.:..:.:|:||:|:|::.||.||.|:.|||.:||:||||:|.|||||.||..|
  Fly   269 DNNVKERIDTFLDFAKTQSQYYRTNNIIVTMGGDFTYQAAQVYYKNLDKLIRYGNERQANGSNIN 333

  Fly   323 LFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQL 387
            |.||||:|||.|||:...|||.|:.|||||.||.::|||||||||||.|||||||||.|||.|||
  Fly   334 LLYSTPSCYLKSLHDAGITWPTKSDDFFPYASDPHAYWTGYFTSRPTLKRFERDGNHFLQVCKQL 398

  Fly   388 SVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKL 452
            |..|....::....|.::||.:|:||||||||||||:.|:.||.:.:..|......|.|:.|.:|
  Fly   399 SALAPKKPEEFDPHLTFMRETLGIMQHHDAITGTEKEKVALDYAKRMSVAFRACGATTRNALNQL 463

  Fly   453 T-----NLPNG------EFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENY 506
            |     |:.:.      ||::|..|||:.|..::.: |...:|||||||||..:|||:||...||
  Fly   464 TVQSKDNVKDTSAKYVFEFKTCALLNITSCPVSEAN-DRFALTLYNPLAHTVNEYVRIPVPYSNY 527

  Fly   507 EVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKA-SVDKIA--NYYIKKVASQETKNVAA 568
            .:.|.||..:.|:.||:...::.::.||:..::|:||.| ::..:.  .||::|:.|.|     .
  Fly   528 RIIDNKGVTLESQAVPIPQVLIDIKHRNSTAKYEIVFLATNIPALGYRTYYVEKLDSTE-----G 587

  Fly   569 HTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMN 633
            :|:||          .:|||...|                ||:..|.::|..|. .|.|..|..:
  Fly   588 NTRSK----------ALPKRTSSV----------------TVIGNSHIQLGFDT-NGFLSEVTAD 625

  Fly   634 GVSENIDQSYGVYR----------TYDSGAYVFR----QYHQADFIVQYEGVEFTVYDGALVKEV 684
            |::..:.|.:..|.          ...||||:||    :.|.|.     :.||..||.|.||.||
  Fly   626 GLTRLVSQEFLFYEGAVGNNAEFLNRSSGAYIFRPNENKIHFAT-----DQVEIEVYKGDLVHEV 685

  Fly   685 HQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIK 749
            ||:|:::||||:|:|...:..|.||.||||..::..|:||:..|||.|||||:..||||||||||
  Fly   686 HQKFNDWISQVVRVYNKDSYAEFEWLVGPIPIDDGIGKEVITRFNSDIASDGIFRTDSNGREMIK 750

  Fly   750 RVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLV 814
            |..:.|:|::..:: :..|.||||:|::|.::|...|:|:|.||||||:|:.:|.||||:||||:
  Fly   751 RKINHRDTWSVKIN-EAVAGNYYPITTKIDVEDDTARMAILTDRAQGGSSLKDGSLELMVHRRLL 814

  Fly   815 RDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAA-----EREAEKEIHLPFWKFFSKNTG 874
            :||.:||||||||.:||..:|||||.:|....|.:....     ||..:.|..||.||||| |..
  Fly   815 KDDAFGVGEALNETEYGDGLIARGKHHLFFGKSTDREGVSLKGIERLTQLEKLLPTWKFFS-NME 878

  Fly   875 STTAAAKSVPSFNDF-------PKSVHLLTLEPFNDDEVLLRVENFLDHTE----GQVVSFNIRP 928
            ..:|........|.|       ||.||||||||::::::|:|.|:.:::.|    .|.|.||::.
  Fly   879 DYSADEWQTAFTNIFSGISLVLPKPVHLLTLEPWHENQLLVRFEHIMENGEDASYSQPVQFNVKN 943

  Fly   929 IFDYLNGVEIRETTLDGNLPLSDMKRFKFHHD---------SSGQKPDAVEYFTSAHKP-LAAEQ 983
            :....:...|||||||||..|.:.:|.:|..|         ::..:|....:..||.|| |..:.
  Fly   944 VLSAFDVEGIRETTLDGNAWLDESRRLQFAPDPEEAAFNTYATFSQPAESVHLLSAEKPMLGVKY 1008

  Fly   984 SQEA----------------------------------------------SEFSVTLHPMQIRTF 1002
            :.||                                              .|:.:.|.||:||||
  Fly  1009 ADEALPAGQLGAESNRIRRETETRQEKKDEGRSSKSTEGPYNSFKSDSSNQEYIIELSPMEIRTF 1073

  Fly  1003 II 1004
            |:
  Fly  1074 IV 1075

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 164/276 (59%)
Alpha-mann_mid 359..434 CDD:286360 47/75 (63%)
Glyco_hydro_38C 482..1002 CDD:285047 214/609 (35%)
LManIINP_609408.1 GH38N_AMII_LAM_like 47..323 CDD:212121 164/276 (59%)
Alpha-mann_mid 370..445 CDD:214875 47/75 (63%)
Glyco_hydro_38C 502..957 CDD:285047 190/494 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053950
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.