DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and LManI

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster

Alignment Length:979 Identity:596/980 (61%)
Similarity:737/980 (75%) Gaps:45/980 (5%)


  Fly    37 MINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAK 101
            |||:|:|||||||||||||||||:||.::.|||||||||:|||:.||:||.:||||||||.||||
  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65

  Fly   102 WWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRI 166
            |::||:||.::.|:|||.:|||||.||||||||||.|:||||:|||.|||::|.||||.|.||.:
  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130

  Fly   167 GWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDASDSLSNDEIFTGLLY 231
            ||||||||||||.|||||||.::||||||||:.||..|:.:|.|||||.:|:||.|..||||:||
  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195

  Fly   232 RHYSAPPGYCFDVHCGDDPIIDTKSYDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYED 296
            .|||||||:|||::|.|.||||.:||||||.:||.:|:.||.::::.|||.|||:||||||||||
  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260

  Fly   297 AQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWT 361
            |.||||||||||||||:||:.||..|:|||||:|||..||:..|||||||:|||||.||.:||||
  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325

  Fly   362 GYFTSRPTQKRFERDGNHILQVAKQLSVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHV 426
            ||||||||||||.|||||..|..|||||.|.|:..|..|||:.|.:.||:||||||:||||||.|
  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390

  Fly   427 SDDYDRILYDAILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAH 491
            :.||||:|:.||:|..|:|||.||.||||.:|||||||:||||.||||:|.|:||:|||.|||||
  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455

  Fly   492 TSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIK 556
            :||||||||.|||||.|||||||.|.||||||.|||||||.|.|||||||||:||||||||:.|:
  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLIR 520

  Fly   557 KVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVID 621
            .:.|  .||:|            |..::.|               .:..:.|..|:||.|||..|
  Fly   521 VLPS--PKNIA------------EDQVQFP---------------VERSQDELTVETSLVKLTFD 556

  Fly   622 NKTGLLKTVEMNGVSENIDQSYGVYRTY----------DSGAYVFRQYHQADFIVQYEGVEFTVY 676
            ..||.||||:|||.:|||.|::|:|:.|          .|||||||.|  .|..:....||.:.|
  Fly   557 TTTGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPY--GDIEIVNNKVELSFY 619

  Fly   677 DGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTD 741
            :|..||||||..:|:|||||||||..|.||.||.||||..:::.|:|::..|:|.|:|.|..|||
  Fly   620 NGTKVKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTD 684

  Fly   742 SNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLE 806
            |||||:::|.::|||.|||.:. :..:.||||||.:|:|||.:|||.:||||||||.|:.:|:||
  Fly   685 SNGREILERERNQREHFTPDMS-EAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELE 748

  Fly   807 LMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSK 871
            |||||||:.||.:||||||||.:||..:|||||:||||...| ....:|..:.::...|||||||
  Fly   749 LMLHRRLLNDDAFGVGEALNETQYGTGLIARGKIYLILDAVD-GKPNQRLLQHQLDQHFWKFFSK 812

  Fly   872 NTGSTTAAAKSVPSFNDFPKSVHLLTLEPFNDDEVLLRVENFLDHTEGQVVSFNIRPIFDYLNGV 936
            :.|..:.....:|.|...|:||.||:|||::.|::|:|:|||  :|||.||||||.|:|:.|:|.
  Fly   813 SNGVASVNRNMIPDFFGIPESVELLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGY 875

  Fly   937 EIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRT 1001
            :|.|||||||:.|.|:|||||..|.:|..|.:|||:.:.|.||.|..:..||.|.|||.||||||
  Fly   876 QIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRT 940

  Fly  1002 FIIK 1005
            |||:
  Fly   941 FIIQ 944

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 196/274 (72%)
Alpha-mann_mid 359..434 CDD:286360 52/75 (69%)
Glyco_hydro_38C 482..1002 CDD:285047 280/530 (53%)
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 196/274 (72%)
Alpha-mann_mid 323..398 CDD:286360 52/75 (69%)
Glyco_hydro_38C 536..941 CDD:285047 214/426 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053783
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.