DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and LManIII

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster

Alignment Length:1008 Identity:695/1009 (69%)
Similarity:840/1009 (83%) Gaps:6/1009 (1%)


  Fly     1 MKYLCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRS 65
            |..:..:.:.:||.|..:..||..| ||:||:||:||||||:|||||||:|||||||||:||::.
  Fly     1 MSSVKNLAILLALFASYIVQSEAVC-YESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNKH 64

  Fly    66 NIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAW 130
            ||||||||||.|||:|||.||..||||||||.||||||.:||||.|::|:.||||||||||||||
  Fly    65 NIQHAGVQYIFDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAW 129

  Fly   131 SMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFAR 195
            |||||||||||||||||.:|||||:|.||.|.|||:|||||.|||||||||:||||.:||:||||
  Fly   130 SMNDEAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQASMFAQMAFDGQFFAR 194

  Fly   196 MDHRDKNDRIDNLGMEMIWDASDSLSNDEIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKSYDNN 260
            ||..|||.|:||||:||:||||::|...:.|||:||.|||||||:|||..|.||||||.||||||
  Fly   195 MDQNDKNKRVDNLGLEMVWDASETLEEMDFFTGMLYNHYSAPPGFCFDSLCQDDPIIDGKSYDNN 259

  Fly   261 VKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFY 325
            |||||||||:|.:::|.:|||||||:|||||||||:|.:|:|||||||||||||||.||.:|:||
  Fly   260 VKSRVDDFLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKLIKYVNERQASGSKYNIFY 324

  Fly   326 STPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVF 390
            ||..|||||||:.||::|||||||.|:..:..|:|||:||||||||||||||||||||||||||.
  Fly   325 STAGCYLNSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNHILQVAKQLSVL 389

  Fly   391 AELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTNL 455
            |:|:.::|.:||:|||:||.||||||||||||||.||:||||:||||||||.|||||.||.|||.
  Fly   390 ADLSGEEQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRLLYDAILGGANTARDALRVLTNQ 454

  Fly   456 PNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEV 520
            |||||:|||:||||||||||::||:.:||||||||||||||||||||.::|:||||||.:||||:
  Fly   455 PNGEFQSCLKLNISECAFTKENADDFMVTLYNPLAHTSTQYVRVPVKEDSYQVTDEKGGLVASEL 519

  Fly   521 VPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEV 585
            |||.|:||:||||||||||||||||||:|||.|:|||:......::..:|::::|:..||:|::|
  Fly   520 VPVPWEVLSLEFRNNDTQHELVFKASVNKIATYFIKKIDKTTEVDITVNTQTEQSVNEEESNVKV 584

  Fly   586 PKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQSYGVYRTYD 650
            |||||||||||...||.||.  ||:||.|.:||||||.||.|||||||||||:|||::|:|:|..
  Fly   585 PKRFKKVHSLKTDLETLDDQ--ETIVQNSLIKLVIDNNTGRLKTVEMNGVSEDIDQTFGMYKTAR 647

  Fly   651 SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIE 715
            |..|:|||  .||..:..:..:||||||..||||||..:|:||||||||||.|.||.||.|||:.
  Fly   648 SCHYIFRQ--DADLELVEDAFDFTVYDGESVKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVP 710

  Fly   716 REEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIAL 780
            .::|.|:|:|.||.|.|:|.||.|||||||||::|.||:||.|:|.|..||.:.||||||||:||
  Fly   711 IDDELGKEIVTIFKSGISSGGVFYTDSNGREMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMAL 775

  Fly   781 QDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILS 845
            |||.||:.:||||:|||||:.:|:||:|||||.:..||.|..||:||:::|:.:|||||::|.|:
  Fly   776 QDSSKRMVLLNDRSQGGASLEDGRLEMMLHRRHIFADGSGAAEAINEQQFGKGLIARGKLFLYLN 840

  Fly   846 P-SDESTAAEREAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLEPFNDDEVLLR 909
            . .|.:||:||.|||||||||||||||:....:...|::..|||.|:|||||||||::.||:|||
  Fly   841 AIEDGATASERVAEKEIHLPFWKFFSKSNNIQSDVTKTLSDFNDLPQSVHLLTLEPYSKDEILLR 905

  Fly   910 VENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTS 974
            :|||||.|||.||||:||.|||.|.|:||||||||||||||||||.|||||.||......|||||
  Fly   906 LENFLDQTEGNVVSFSIRQIFDDLGGLEIRETTLDGNLPLSDMKRLKFHHDGSGPSHSVPEYFTS 970

  Fly   975 AHKPLAAEQSQEASEFSVTLHPMQIRTFIIKTE 1007
            .||||||:::|:||||||||.||||||||||.|
  Fly   971 LHKPLAADKTQDASEFSVTLKPMQIRTFIIKKE 1003

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 211/274 (77%)
Alpha-mann_mid 359..434 CDD:286360 59/75 (79%)
Glyco_hydro_38C 482..1002 CDD:285047 337/521 (65%)
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 211/274 (77%)
Alpha-mann_mid 358..433 CDD:286360 59/75 (79%)
Glyco_hydro_38C 603..998 CDD:285047 255/399 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053458
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.