DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2a2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_008757749.1 Gene:Man2a2 RGDID:1310238 Length:1175 Species:Rattus norvegicus

Alignment Length:1134 Identity:291/1135 (26%)
Similarity:473/1135 (42%) Gaps:292/1135 (26%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.||:||.|:|:...        .|:|:::::::|.:||.|||:..|.||||||
  Rat   166 LQVFVVPHSHNDPGWIKTFDKYYTEQ--------TQHILNSMVSKLQEDPRRRFLWAEVSFFAKW 222

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |...|...:..||:||..|:||...|.|.|.|||..:|.:::||...|.::|:...|  |.||.|
  Rat   223 WDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLG--ATPRSG 285

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSNDEIFTGLLY 231
            |.:||||||.....:..:.........|:.:..|........:|.:|..: ||.|:.:||..:: 
  Rat   286 WAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMM- 349

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|| | ||.||.|    |.|..                 :.||..|....|....
  Rat   350 ------PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYR 408

  Fly   274 SVAQHYRSNHIMIPMGDDFQYE-----DAQVNFKNMDKLIKYVNER-----QAEGSTFNLFYSTP 328
            ..::.:||:.:::|:||||:|:     |||  |.|..:|..::|.:     ||:       :.|.
  Rat   409 KKSRLFRSSVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFLNSKPEFHVQAQ-------FGTL 464

  Fly   329 ACYLNSLHE--GLQT------WPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAK 385
            :.|.::|::  |::.      :|..:.|||.|...::.|||||:||||..|..:|.....|:.|:
  Rat   465 SEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLETHLRGAE 529

  Fly   386 QLSVFAELNTKQQKEDLEY----------LREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILG 440
            .|...|..:.::.....:|          .|..:|:.|||||||||.|:.|..||          
  Rat   530 VLYSLALAHARRSGLTGQYPLSDYAVLTEARRTLGLFQHHDAITGTAKEAVVVDY---------- 584

  Fly   441 GVNTARDGLRKLTNL----------------------PNGEFESCLQLN--------ISECAFTK 475
            ||..    ||.|.:|                      |...|   ||::        :.|....:
  Rat   585 GVRL----LRSLVSLKQVIINAAHYLVLGDKETYSFDPRAPF---LQMDDSRVSHDALPERTVIR 642

  Fly   476 DDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVV----------ASEVVPVAWQV--- 527
            .|:....|.::|||.......|.:.|.:....|..|:|:.:          |:.:||..:||   
  Rat   643 LDSSPRFVVVFNPLEQERLSVVSLLVNSPRVRVLSEEGQPLSVQISVQWSSATNMVPDVYQVSVP 707

  Fly   528 -------LALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEV 585
                   |.:.....|.......::||....| .:|...|::|      |...|.:.:..::..:
  Rat   708 VRLPALGLGVLQLQPDLDGPYTLQSSVHVYLN-GVKLSVSRQT------TFPLRVVDSGTSDFAI 765

  Fly   586 PKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQS-------Y 643
            ..|:.:|.                          ....|||||:|..  |.|..:|.       |
  Rat   766 SNRYMQVW--------------------------FSGLTGLLKSVRR--VDEEQEQQVDMKLFVY 802

  Fly   644 GVYRTYD-SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIY-----EGK 702
            |...:.| ||||:|...::|...|..:.....|.:|....|| ..:.|:..||||:|     ||.
  Rat   803 GTRTSKDKSGAYLFLPDNEAKPYVPKKPPVLRVTEGPFFSEV-AAYYEHFHQVIRLYNLPGVEGL 866

  Fly   703 NLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNG-----REMIKRVKDQRETFTPGL 762
            :| ::.:||   :..:...:|:.:..::.|.|.|..:||.||     |:.:|::           
  Rat   867 SL-DVSFQV---DIRDYVNKELALRIHTDIDSQGTFFTDLNGFQVQPRKYLKKL----------- 916

  Fly   763 DRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNE 827
               |..||:||:.....:|||::|:.:...:|.|.:|:.|||||::|.|||::||..|:|:.|.:
  Rat   917 ---PLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQLEVILDRRLMQDDNRGLGQGLKD 978

  Fly   828 EK----YGQPMIARGKVYLILSPS----------------DESTAAEREAEKEIHLPFWKFFSKN 872
            .|    :.:.::.|   ..::||.                ..:|....:.::|....:....|..
  Rat   979 NKITCNHFRLLLER---RTLMSPEPGFFSKLAAMFRGLIFSSNTIRNSKVQQERSTSYPSLLSHM 1040

  Fly   873 TG----------------STTAAAKSV-PSFNDFPKSVHLLTLE--------PFNDDEVLLRVEN 912
            |.                ||:....|. |..:..|...|||.|.        |..|..::|..:.
  Rat  1041 TSMYLNTPPLVLPVAKRESTSPTLHSFHPLASPLPCDFHLLNLRMLPAEDTLPAADAALILHRKG 1105

  Fly   913 FLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHH-DSSGQKPDAVEYFTSAH 976
            |....|.:.:.||.              ||..|.|.|..:    ||. |....:|.::...    
  Rat  1106 FDCGLEAKNLGFNC--------------TTSQGKLALGSL----FHGLDVLFLQPTSLTLL---- 1148

  Fly   977 KPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            .|||:    .::...::|.||:|.||.::
  Rat  1149 YPLAS----PSNSTDISLEPMEISTFRLR 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 98/303 (32%)
Alpha-mann_mid 359..434 CDD:286360 31/85 (36%)
Glyco_hydro_38C 482..1002 CDD:285047 137/604 (23%)
Man2a2XP_008757749.1 PLN02701 140..1174 CDD:178304 291/1135 (26%)
CE4_SF 165..508 CDD:301698 115/368 (31%)
Alpha-mann_mid 503..588 CDD:214875 33/95 (35%)
Glyco_hydro_38C 761..1170 CDD:285047 113/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.