DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2a1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_037111.2 Gene:Man2a1 RGDID:3038 Length:1148 Species:Rattus norvegicus

Alignment Length:1103 Identity:270/1104 (24%)
Similarity:460/1104 (42%) Gaps:256/1104 (23%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.|||||.:.||        ....|||.:.::.:|.:|.:|:||..|.|:.|||
  Rat   165 LQVFVVPHSHNDPGWLKTFNDYF--------RDKTQYIFNNMVLKLKEDSSRKFIWSEISYLAKW 221

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |.......|:.|:.|:..|:||...|.|.|.|||..:|.::|||...|.::|:...|  .:||.|
  Rat   222 WDIIDNPKKEAVKSLLQNGQLEIVTGGWVMADEATTHYFALIDQLIEGHQWLEKNLG--VKPRSG 284

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSNDEIFTGLLY 231
            |.|||||||.....:..:.|:......|:.:..|........:|..|..: |..|..:|...:: 
  Rat   285 WAIDPFGHSPTMTYLLKRAGFSHMLIQRVHYSVKKHFSLQKTLEFFWRQNWDLGSTTDILCHMM- 348

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|: | ||.||.|    |.|..                 ..||:||....|....
  Rat   349 ------PFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYR 407

  Fly   274 SVAQHYRSNHIMIPMGDDF---QYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSL 335
            ..::.:|:..::.|:||||   :|.:..:.::|.::|..|:|.:  ......:.:.|.:.|.::|
  Rat   408 KKSKLFRTKVLLAPLGDDFRFSEYTEWDLQYRNYEQLFSYMNSQ--PHLKVKIQFGTLSDYFDAL 470

  Fly   336 HE--------GLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE 392
            .:        |...:|..:.|||.|...|:.||:|||||||..||.:|.....|:.|:   :...
  Rat   471 EKSVAAEKKGGQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRLRTAE---ILYH 532

  Fly   393 LNTKQQKE-------------DLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILY------DAI 438
            |..||.::             .|...|..:|:.|||||||||.|..|..||...|:      :.|
  Rat   533 LALKQAQKYKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKI 597

  Fly   439 LGG--------------------------VNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDD 477
            :|.                          ..:::|.|.|         ::.:||:..|..:    
  Rat   598 IGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPK---------KNIIQLSAQEPRY---- 649

  Fly   478 ADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELV 542
                 :.:|||........|.|.|.:...:|..:.|:.|..:|..| |:.:.   ..:...:|:.
  Rat   650 -----LVVYNPFEQERHSVVSVRVNSATVKVLSDLGKAVEVQVSAV-WKDMR---TTSQAAYEVA 705

  Fly   543 FKASVDKIANYYIKKVASQ-ETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDE 606
            |.|.:..:.....|.:.|| .:.::|.:.......:||..          :..:||..     |.
  Rat   706 FLAHLPPLGLKVYKILESQSSSSHLADYFLYNNDGQAESG----------IFHMKNMV-----DS 755

  Fly   607 GETV-VQTSQVKLVIDNKTGLLKTVEMNGVSENIDQS-------YGVYRTYD-SGAYVFRQYHQA 662
            |:.: ::.|.:.|..| ::||::.|...  .:|..|.       ||.....| ||||:|....|.
  Rat   756 GDAITIENSFLTLGFD-RSGLMEKVRRK--EDNKQQELKVQFLWYGTTNKRDKSGAYLFLPDGQG 817

  Fly   663 DFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIY-----EGK-----NLVEIEWQVGPIERE 717
            ...|........|..|.:..:| ..|.|:::..:|:|     ||:     |:|:|         .
  Rat   818 QPYVSLRTPFVRVTRGRIYSDV-TCFLEHVTHKVRLYHIQGIEGQSMEVSNIVDI---------R 872

  Fly   718 EEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQD 782
            ....||:|:..:|.|.:....|||.||.::     ..|.|    :.:.|..||.||:::...:||
  Rat   873 SVHNREIVMRISSKINNQNRYYTDLNGYQI-----QPRRT----MAKLPLQANVYPMSTMAYIQD 928

  Fly   783 SKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPS 847
            :..|:.:|:.::.|.:||.:||:|:.:.|||::||..|:|:.:::.|      ....::.||  .
  Rat   929 AAHRLTLLSAQSLGASSMASGQIEVFMDRRLMQDDNRGLGQGVHDNK------ITANLFRIL--L 985

  Fly   848 DESTAAEREAEKEIHLPFWKFFSKNTGS---------------TTAAAKSVPSF----NDFPKSV 893
            ::......|.:|:..:.:....|..|.:               .:.|.:.:..|    :..|..:
  Rat   986 EKRNGMNMEEDKKSPVSYPSLLSHMTSAFLNHPFLPMVLSGQLPSPAIELLSEFRLLQSSLPCDI 1050

  Fly   894 HLLTL--------EPFNDDEVLLRVENFLDHTEGQVVSFNIRPIFD---YLNGVEIRETTLDGNL 947
            ||:.|        :.::|:..|:.      |          |.:||   ....:.:..:|..|.:
  Rat  1051 HLVNLRTIQSKVGKGYSDEAALIL------H----------RKVFDCQLSSRAMGLPCSTTQGKM 1099

  Fly   948 PLSDMKRFKFHHDSSGQKPDAVEYFTSA-----HKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            .:..:    |::       .|||.|..:     |.|..|:.:.|     |:|.||:|.|..|:
  Rat  1100 SIPKL----FNN-------FAVESFIPSSLSLMHSPPDAQNTSE-----VSLSPMEISTSRIR 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 91/301 (30%)
Alpha-mann_mid 359..434 CDD:286360 33/88 (38%)
Glyco_hydro_38C 482..1002 CDD:285047 125/575 (22%)
Man2a1NP_037111.2 PLN02701 127..1148 CDD:178304 270/1104 (24%)
GH38N_Man2A1 164..507 CDD:212131 106/361 (29%)
Alpha-mann_mid 502..587 CDD:214875 33/88 (38%)
Glyco_hydro_38C 733..1142 CDD:285047 105/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.