DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and ams1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_593979.1 Gene:ams1 PomBaseID:SPAC513.05 Length:1077 Species:Schizosaccharomyces pombe

Alignment Length:1035 Identity:199/1036 (19%)
Similarity:362/1036 (35%) Gaps:292/1036 (28%)


  Fly    28 EACPKTKTNMINIHMVPHSHDDVGWL--------KTVDQYFYGHRSNIQHAGVQYIIDTVIAELI 84
            ||..:...:..|:..:.|.|.|..||        |.|..  :..:.||.....:|       :.:
pombe   271 EAVFEKNNDKANVFAIGHCHIDTAWLWPFAETRRKIVRS--WATQMNIMDRYPEY-------QFV 326

  Fly    85 KDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTL 149
            ...|.:::         |..|......:.:::.||:.:....||:|..:|....|.:|:|.||.|
pombe   327 CSQALQYL---------WLKEDHPDVFEKLKEYVNQNKFIPIGGSWVEHDTNIPNGESLIRQFLL 382

  Fly   150 GLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW 214
            |..|.:..||  .|.|..|..|.||:|.:...|....|.| .|               |..::.|
pombe   383 GQHFFEKEFG--VRCRTFWLPDTFGYSSQIPQICRLCGMD-RF---------------LTQKLSW 429

  Fly   215 DASDSLSNDEIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKSYDNNVKSRVDDFLSYVTSVAQHY 279
            :..:|......       ::.|..|.....|.   |..:|.:.|.|    |:|.|.   |:.||.
pombe   430 NNINSFPTSTF-------NWVALDGSQVICHM---PPANTYTADTN----VNDVLH---SIDQHK 477

  Fly   280 -----RSNHIMIPMGDDFQYEDAQV-----NFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNS 334
                 ::..::..:||.......::     ..|.:...:.|:...:. |:|.:.|:..   .|..
pombe   478 NLVNDQAGLLVFGIGDGGGGPTPEMLEKLRRCKGIANTVGYLPNVKL-GNTVDEFFDG---ILKR 538

  Fly   335 LHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAELNTKQ-- 397
            .:.| ||.|:...:.:      ..:..|.:|::...|:..|.....|..|:.:|..|.:.:|.  
pombe   539 TNAG-QTLPSWNGELY------FEFHRGTYTTQAELKKLMRKVEIALHDAEYVSTLASIFSKDYS 596

  Fly   398 -QKEDLEYLREIMGVMQHHDAITGTEKQHVSDD-----------YDRILYDAILGGVNTARDGLR 450
             .||.|:.|.....:.|.||.:.|:..:.|..|           .:.:|:.||      .:.|.:
pombe   597 YPKESLQDLWRDTLLCQFHDVLPGSCIEMVYKDAIPIMSKVLKNTEALLWQAI------EQLGFK 655

  Fly   451 KLTNLPNGEFESCLQLN---------ISECA------FTKDDADNVVVTLYNPLAHTSTQYVRVP 500
            |.::..|.| :.|| ||         |:|..      |...|...::...:..|.|.:..|    
pombe   656 KASSSDNKE-QLCL-LNTLPWNVRGVITETEENKLVYFESCDGKGILTAAHTSLKHPAAAY---- 714

  Fly   501 VKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKN 565
            .|::|:.:.::..||.      :|...|.|...:...:.|::                   :.|:
pombe   715 QKDDNFILVNDHLRVT------IAPNGLILSLFDLHKEREIL-------------------DLKS 754

  Fly   566 VAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDD-DEGETVVQTS---QVKLVID----N 622
            ...|..:.:.:..|:..|.......:|.||    |.::. |:|:..::.|   :..:|:|    .
pombe   755 GKNHAGANQYVLFEDTPLSWQAWDTEVFSL----EKYEVLDKGKVSIKESGPLRASVVVDIPISE 815

  Fly   623 KTGLLKTVEMNGVSENIDQSYGVYRTYDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQ 687
            .:.:..|:.:.|.:: ..:..||..|.:.      .:|::   .::..|||.|       ::|.:
pombe   816 LSHMKATISLEGYND-CSEFTGVNFTCEV------DWHES---CKFLKVEFPV-------DIHSE 863

  Fly   688 FSEYISQVIRIYEGKNLVEIEWQVGPIE-REEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRV 751
            |:.|.:| ..|.:........|.|...| ..::|                ..|:|          
pombe   864 FASYETQ-FGITKRPTHYNTSWDVAKFEVCHQKF----------------ADYSD---------- 901

  Fly   752 KDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRD 816
                  ||.|                         ::|||| .:.|.|.....:.|.|.|...:.
pombe   902 ------FTYG-------------------------VSVLND-CKYGFSTHGNLMRLSLLRSPKQP 934

  Fly   817 DGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSKNTGSTTAAAK 881
            |.:.        ..|:..| |..||....|.|.||.  |.|.|         |:.|....|.|:.
pombe   935 DAHA--------DMGKHTI-RYAVYPHSKPLDSSTV--RAAHK---------FNSNFRLLTRASD 979

  Fly   882 SVPSFNDFPKSVHLLTLEPFNDDEVLLRVENFLDH----TEGQVVSFNIRPIFDYLNGVEIRETT 942
            :.             .|:.|:..:::......|.|    .:|:.:   |..:::.|.| :.|...
pombe   980 TA-------------NLDIFDAFQLVGEPNVILSHIKMAEKGKSI---ILRVYESLGG-KSRARL 1027

  Fly   943 LDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTF 1002
            :..:|.::.:.:      .:|.:.|..|        |...:|.:..|..:.|...:|.||
pombe  1028 VIKSLTVASVTK------CNGLEEDLEE--------LCTLKSNDYYEVPIELRAFEIATF 1073

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 61/292 (21%)
Alpha-mann_mid 359..434 CDD:286360 19/89 (21%)
Glyco_hydro_38C 482..1002 CDD:285047 93/533 (17%)
ams1NP_593979.1 AMS1 44..1077 CDD:223460 199/1036 (19%)
GH38N_AMII_ScAms1_like 282..538 CDD:212123 65/313 (21%)
Alpha-mann_mid 555..634 CDD:286360 19/79 (24%)
Glyco_hydro_38C 664..1073 CDD:285047 102/571 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.