DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and MAN2B2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_056089.1 Gene:MAN2B2 HGNCID:29623 Length:1009 Species:Homo sapiens

Alignment Length:1117 Identity:307/1118 (27%)
Similarity:472/1118 (42%) Gaps:226/1118 (20%)


  Fly     1 MKYLCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRS 65
            |..||.:.|...||.:. .|..::.|          .|...:|||||.||||:.||.:....:.:
Human     1 MGQLCWLPLLAPLLLLR-PPGVQSAG----------PIRAFVVPHSHMDVGWVYTVQESMRAYAA 54

  Fly    66 NIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWW-AEQSETAKQVVRKLVNEGRLEFTGGA 129
            |        :..:|:.||.:...||||.||..||..|| ...|:..|..||:|:.||||||..|.
Human    55 N--------VYTSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGG 111

  Fly   130 WSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFA 194
            ..|:|||..:....|.|.|.|..||.:|||  .||:..|.:||||.|....::||..|::....:
Human   112 QVMHDEAVTHLDDQILQLTEGHGFLYETFG--IRPQFSWHVDPFGASATTPTLFALAGFNAHLGS 174

  Fly   195 RMDHRDKNDRIDNLGMEMIWDASDSLS-NDEIFTGLLYRH-YSAPPGYCFDVHCG---------- 247
            |:|:..|....:..|::.:|..|.||| ..||||.::.:: |..|....|....|          
Human   175 RIDYDLKAAMQEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFP 239

  Fly   248 -----------DDPIIDTKSYDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNF 301
                       .:|:...     |:....:..::.|...|..:|:.|::.|.|.|.|:.:|.|.|
Human   240 KPPQDGVYPNMSEPVTPA-----NINLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQF 299

  Fly   302 KNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNKT-QDFFPYGSDDNSYWTGYFT 365
            .|||.|:.::|...||... ::.|:|...|..:||....||..:. .||.||.::....|||::|
Human   300 ANMDPLLDHINSHAAELGV-SVQYATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTGFYT 363

  Fly   366 SRPTQKRFERDGNHILQVAKQLSVF---------AELNTKQQKEDLEYLREIMGVMQHHDAITGT 421
            ||.:.|...|..:.:|...:  |:|         ..|:.....:.|:.||..:..:|||||||||
Human   364 SRSSLKGLARRASALLYAGE--SMFTRYLWPAPRGHLDPTWALQQLQQLRWAVSEVQHHDAITGT 426

  Fly   422 EKQHVSDDYDRILYDAILGGVNTARDGLRKL-TNLPNGEFESCLQLNISECAFTKDDADNVVVTL 485
            |...|.|.|...|...:|        |:||| .::...|    ||......|.:.........::
Human   427 ESPKVRDMYATHLASGML--------GMRKLMASIVLDE----LQPQAPMAASSDAGPAGHFASV 479

  Fly   486 YNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEV-----VPVAWQVLALEFRNNDTQHELVFKA 545
            |||||.|.|..|.:.|......||||.|..|.|::     .|.|:.:|.|     .|...|.:: 
Human   480 YNPLAWTVTTIVTLTVGFPGVRVTDEAGHPVPSQIQNSTETPSAYDLLIL-----TTIPGLSYR- 538

  Fly   546 SVDKIANYYIKKVA-SQE-TKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGE 608
                  :|.|:..| :|| |:..||...|         .|:..:|.::..|          ..|.
Human   539 ------HYNIRPTAGAQEGTQEPAATVAS---------TLQFGRRLRRRTS----------HAGR 578

  Fly   609 TVVQTSQ--VKLVIDNKTGLLKTV--EMNGVSENIDQSYGVYRTYD-------SGAYVFRQYHQA 662
            .:|..:.  ..:::|..|.|:.::  ..:..:..:.|.:..|....       |..|:|.....|
Human   579 YLVPVANDCYIVLLDQDTNLMHSIWERQSNRTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAA 643

  Fly   663 DFIVQYEGVEFTVYDGALVKEVHQQF------SEY-------ISQVIRIYEGKNL---VEIEWQV 711
              :..:|.||..:..|.||.|:.|.|      ..|       ::.|.:.::|:.|   :|.|:|.
Human   644 --VPAWEAVEMEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQA 706

  Fly   712 GPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTS 776
            ||:    |..||.|:..::.:.|..|.|:|:||.:|      ||..:...::.. .|.||||:..
Human   707 GPL----ELNREAVLRTSTNLNSQQVIYSDNNGYQM------QRRPYVSYVNNS-IARNYYPMVQ 760

  Fly   777 RIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVR----DDGYGVGEALNEEKYGQPMIAR 837
            ...::|.|.|:.:|::||.|.:|..|||:|:||||||..    |.||.:  .||:.....|::  
Human   761 SAFMEDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNL--TLNDTSVVHPVL-- 821

  Fly   838 GKVYLILSPSDESTA-AEREAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLEP- 900
               :|:|.....:|| .:|.|....|.|...|     |.....|..:|.    |:....:||.| 
Human   822 ---WLLLGSWSLTTALRQRSALALQHRPVVLF-----GDLAGTAPKLPG----PQQQEAVTLPPN 874

  Fly   901 --------------FNDDE-------------------VLLRVENFLDHTE----GQVVSFNIRP 928
                          .|..|                   ||||:.:..:..|    .|.|:.|:..
Human   875 LHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEA 939

  Fly   929 IFDYLNG-VEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSV 992
            :...|.. |.:.|.:|.|...||.:.|:.:.......:.|.    ||..:|....        .:
Human   940 VLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDT----TSPSRPPGGP--------II 992

  Fly   993 TLHPMQIRTFII 1004
            |:||.:||||.|
Human   993 TVHPKEIRTFFI 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 96/298 (32%)
Alpha-mann_mid 359..434 CDD:286360 28/84 (33%)
Glyco_hydro_38C 482..1002 CDD:285047 149/598 (25%)
MAN2B2NP_056089.1 GH38N_AMII_Epman_like 27..352 CDD:212122 110/341 (32%)
Alpha-mann_mid 358..439 CDD:214875 28/83 (34%)
Glyco_hydro_38C 581..1002 CDD:285047 114/462 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.