DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and aman-1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_508811.1 Gene:aman-1 WormBaseID:WBGene00018877 Length:955 Species:Caenorhabditis elegans

Alignment Length:1001 Identity:348/1002 (35%)
Similarity:512/1002 (51%) Gaps:147/1002 (15%)


  Fly     7 IVLFVALLAISVRPSEEACGYEACPKT--KTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQH 69
            |.||:.||.|.   |.:.|.:..|.|.  ..|:|..|::||:|||:||:|||||||:|.:..:..
 Worm     6 IFLFLGLLVIY---SSQDCAWNTCHKVDQDPNVITAHLIPHTHDDLGWIKTVDQYFWGAKPELVP 67

  Fly    70 AGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMND 134
            .|||||.:|||.||:|:|.|||...||.|..:|:...|:..:..::|||..|::|..||.|..||
 Worm    68 VGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQND 132

  Fly   135 EAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHR 199
            ||..:|..:|||.||||:.|:..||.|.:|..||||||||||||.|:|:.:|||...:|||:.:.
 Worm   133 EATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYL 197

  Fly   200 DKNDRIDNLGMEMIWDASDSLSNDEIFTGLLYR-HYSAPPGYCFDVHCGDDPIIDTKSYDN-NVK 262
            :|..|:.|..:|.:|:.||.::::::|||..:. :|..|.|:|:|..||||||:|..:.:. |||
 Worm   198 EKQIRLKNKTLEFMWNTSDDITDNKLFTGAFFNDNYGPPEGFCWDSLCGDDPIMDNLNIEGYNVK 262

  Fly   263 SRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYST 327
            .:||.|:.:|.:.|.|..:|.:|:.||.||||.:|...:.|:||||||||...::  ...:.|||
 Worm   263 EKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSWYVNLDKLIKYVNADTSK--KVRVIYST 325

  Fly   328 PACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE 392
            ||||..::.....|...|..|||||.|..:|||||||||||..|...|..:.:||:||||.|.|.
 Worm   326 PACYTKAVQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVIAN 390

  Fly   393 LNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTNLPN 457
            |. .:...|:|.|||...::|||||:|||.|::|:.||::.|...:........|.::|:.  |:
 Worm   391 LG-PEDDSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKMN--PD 452

  Fly   458 G---EFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASE 519
            |   :...|..:|.:.|......::..|| ::|.........:|:|...:...:.|....|:.|:
 Worm   453 GLDPKLVLCPLINETICKPINGSSEFSVV-IFNSNGRYFNGTIRIPYSQKTAVLRDAHKNVLESQ 516

  Fly   520 VV-------------------------PVAWQVLALE---------FRNNDTQHELVFKASVDKI 550
            :|                         |:.:..:.:|         |.|...     |..:|: |
 Worm   517 IVETFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFVEKGSKPERVHFNNRKK-----FNTNVE-I 575

  Fly   551 ANYYIKKVASQETKNVAAH-----TKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETV 610
            .|.|:  :|..:::...::     ||.||||:.|                      |...||   
 Worm   576 QNEYL--IAGFDSQGYLSYITEKATKKKRSIRQE----------------------FFYYEG--- 613

  Fly   611 VQTSQVKLVIDNKTGLLKTVEMNGVSENIDQSYGVYRTYDSGAYVFRQYHQADFIVQYEGVEFTV 675
                     ||:|.               ||        .||||:||...|.. |.....:...|
 Worm   614 ---------IDSKD---------------DQ--------PSGAYIFRPKTQQP-IALTSKLALEV 645

  Fly   676 YDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEE--FGREVVIIFNSTIASDGVS 738
            ..||::.||.|:.|.::||.||:..|||.:|.||.||||.:|.:  ..:|.|..:.:.:.|...|
 Worm   646 VPGAIINEVRQKVSPFVSQQIRLPRGKNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQS 710

  Fly   739 YTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNG 803
            :||||||:.::|..|...:|... |.:|.|.||||:||...::|...:.:|:.|||||..:. :|
 Worm   711 FTDSNGRQAMERFFDGATSFEYS-DTEPIAGNYYPITSFGYIKDENAQFSVITDRAQGMVAS-DG 773

  Fly   804 QLELMLHRRLVRDDGYGVGEALNEE-KYGQPMIARGKVYLILSPSDESTAAERE-AEKEIHLPFW 866
            .:|:|||||...||.:||.|||:|. |.|..::|.||..::.:....||:..|. |....|.|..
 Worm   774 VVEIMLHRRCFYDDHFGVEEALDEPGKDGAGLVAMGKHIVLFTDVKASTSQLRPLAIDNFHQPVL 838

  Fly   867 KFFSKNTGSTTAAAKSVPSFN----------DFPKSVHLLTLEPFNDDEVLLRVENFLDHTEG-Q 920
            . |:||....        .||          :.|..:||||||.::....|:|.||.....|| .
 Worm   839 A-FNKNPEKF--------EFNRLLEYSGLKFELPIGIHLLTLEKWHKKSSLIRFENIYHGEEGNS 894

  Fly   921 VVSFNIRPIFDYLNGVEIRETTLDGN 946
            :..|:...||...:.|..:|..|..|
 Worm   895 IKEFDPTHIFTNFDIVSFKELLLGAN 920

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 130/276 (47%)
Alpha-mann_mid 359..434 CDD:286360 38/75 (51%)
Glyco_hydro_38C 482..1002 CDD:285047 144/520 (28%)
aman-1NP_508811.1 GH38N_AMII_LAM_like 36..313 CDD:212121 131/277 (47%)
Alpha-mann_mid 357..431 CDD:286360 38/75 (51%)
Glyco_hydro_38C 537..944 CDD:285047 135/462 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64054220
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 643 1.000 Inparanoid score I433
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T375228
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.