DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and aman-2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_505995.2 Gene:aman-2 WormBaseID:WBGene00010284 Length:1145 Species:Caenorhabditis elegans

Alignment Length:975 Identity:241/976 (25%)
Similarity:420/976 (43%) Gaps:198/976 (20%)


  Fly    27 YEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRF 91
            |:|........:.:.::||||.|.||:.|.::|:.....|        |:|.:...|.:....||
 Worm   170 YDAEKVKSLPRLEVIVIPHSHCDPGWIMTFEEYYNRQTRN--------ILDGMAKHLAEKDEMRF 226

  Fly    92 IQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDD 156
            |..|.|||..||.:|::..|:.|:..:..|:.|...|.|.|.|||..:|.|:|.:...|.:::.:
 Worm   227 IYAEISFFETWWRDQADEIKKKVKGYLEAGKFEIVTGGWVMTDEANAHYHSMITELFEGHEWIQN 291

  Fly   157 TFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW-DASDSL 220
            ..|..|.|:..|.|||||.|.....:............|:.:..|.:......:|..| ....|.
 Worm   292 HLGKSAIPQSHWSIDPFGLSPSMPHLLTSANITNAVIQRVHYSVKRELALKKNLEFYWRQLFGST 356

  Fly   221 SNDEIFTGLLYRHYSAPPGYCFDV-H-CGDDP---------------------IIDTKSYDNNVK 262
            .:.::.:.::       |.|.:|: | ||.:|                     |...|..|:||.
 Worm   357 GHPDLRSHIM-------PFYSYDIPHTCGPEPSVCCQFDFRRMPEGGKSCDWGIPPQKINDDNVA 414

  Fly   263 SRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYE-DAQVN--FKNMDKLIKYVNERQAEGSTFNLF 324
            .|.:.........:|.:::|.|..|:||||:|: |.:.|  ::|..||.:|:|.:    |.:|:.
 Worm   415 HRAEMIYDQYRKKSQLFKNNVIFQPLGDDFRYDIDFEWNSQYENYKKLFEYMNSK----SEWNVH 475

  Fly   325 --YSTPACYLNSLHEGL----QTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHIL-- 381
              :.|.:.|...|...:    :..|..:.|||.|...|:.||:|||||||..|:.:|...|.|  
 Worm   476 AQFGTLSDYFKKLDTAISASGEQLPTFSGDFFTYADRDDHYWSGYFTSRPFYKQLDRVLQHYLRS 540

  Fly   382 -QVAKQLSVFAELNTKQQK--EDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVN 443
             ::|..|:...|....:.|  |.|...|..:.:.||||.:|||.|.||..||.:.:.||:    |
 Worm   541 AEIAFTLANIEEEGMVEAKIFEKLVTARRALSLFQHHDGVTGTAKDHVVLDYGQKMIDAL----N 601

  Fly   444 TARDGLRKLTNLPNGEFESCLQLNISECAFTKD---------DADNVVVTLYNPLAHTSTQYVRV 499
            ...|.|.:...:..| .:|..::.:.|....::         ...|||  |:|.|:..       
 Worm   602 ACEDILSEALVVLLG-IDSTNKMQMDEHRVNENLLPEKRVYKIGQNVV--LFNTLSRN------- 656

  Fly   500 PVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETK 564
              :||                 |:..||.:|:             |.|:  |:..|||   |:..
 Worm   657 --RNE-----------------PICIQVDSLD-------------AGVE--ADPPIKK---QQVS 684

  Fly   565 NVAAHTKSKRSIKAEEANLEV-------PKRFKKVHSLKNAT---------------ET---FDD 604
            .|.|:.:.|:::..:....|:       |........:||.|               ||   ...
 Worm   685 PVIAYDEEKKTLVVKNGIFELCFMLSLGPMESVSFRLVKNTTTSKVEIITNNAAEFKETSFKSSS 749

  Fly   605 DEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQS-----YGVYRT----------YDSGAY 654
            ..|:..|:..:|:...|.:.|::|........:.||.:     ||..::          ..:|||
 Worm   750 TSGDFTVKNDKVEAEFDGENGMIKRATSLVDDKPIDLNSHFIHYGARKSKRKFANGNEDNPAGAY 814

  Fly   655 VFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSE--YISQVIRIYEGKNLVEIEWQVGPIERE 717
            :|....:|..: :.:..::.:..|.:|::|....:.  .|.|...:|:|...::::.:| .:..:
 Worm   815 LFLPDGEAREL-KKQSSDWILVKGEVVQKVFATPNNDLKILQTYTLYQGLPWIDLDNEV-DVRSK 877

  Fly   718 EEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQD 782
            |.|  |:.:.|:|::.|....:||.||.:||||   :|:|      :.||.||:||:::.:.::|
 Worm   878 ENF--ELALRFSSSVNSGDEFFTDLNGMQMIKR---RRQT------KLPTQANFYPMSAGVYIED 931

  Fly   783 SKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPS 847
            ...|:::.:.:|.|.:|:.:||:|:||.|||..||..|:.:.:.:.|   ..:|..::  ::.|.
 Worm   932 DTTRMSIHSAQALGVSSLSSGQIEIMLDRRLSSDDNRGLQQGVRDNK---RTVAHFRI--VIEPM 991

  Fly   848 DESTAAERE------------AEKEIHLPFWKFFSKNTGSTTAAAKSVPSFN---DFPKSVHLLT 897
            ..|:..::|            |...:|.|..|...      .|..||:.|.|   :....:||:|
 Worm   992 SSSSGNKKEERVGFHSHVGHLATWSLHYPLVKMIG------DATPKSISSKNVEQELNCDLHLVT 1050

  Fly   898  897
             Worm  1051  1050

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 80/301 (27%)
Alpha-mann_mid 359..434 CDD:286360 32/80 (40%)
Glyco_hydro_38C 482..1002 CDD:285047 105/474 (22%)
aman-2NP_505995.2 PLN02701 142..1124 CDD:178304 241/976 (25%)
GH38N_AMII_GMII_SfManIII_like 180..521 CDD:212120 96/360 (27%)
Alpha-mann_mid 516..596 CDD:214875 32/80 (40%)
Glyco_hydro_38C 750..1141 CDD:285047 78/326 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.