DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and aman-3

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001021474.1 Gene:aman-3 WormBaseID:WBGene00018594 Length:1064 Species:Caenorhabditis elegans

Alignment Length:1047 Identity:249/1048 (24%)
Similarity:455/1048 (43%) Gaps:235/1048 (22%)


  Fly    29 ACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQ 93
            |..|::|..:.::::|.:|.|.|||:|.::|   .:|..|      |:|.:...::|:...||:.
 Worm   128 ASKKSRTEKLKVYVLPFTHVDPGWLETFERY---TKSTNQ------ILDNMHQFMMKNEKMRFMW 183

  Fly    94 VETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTF 158
            .|..||.:||:.|:|..|:.|:|||.|||||...|:|.|.|||...:...:|....|.:|:...|
 Worm   184 AEFVFFERWWSLQNEQVKEDVKKLVTEGRLELATGSWVMTDEANPYFPVSVDNIVEGFQFIHKNF 248

  Fly   159 GSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW-DASDSLSN 222
            |  .:|:..|..||||:|.....:|.:.|.......|:.|:.|........:...| ...|:...
 Worm   249 G--IKPQTMWSNDPFGYSNSVPYLFKKSGVHRTVINRIHHKLKQTLQSQKAIPFKWRQYFDATGE 311

  Fly   223 DEIFTGLL-YRHYSAPPGYCFDV--HCGDDPII------------------DTKSYDNNVKSRVD 266
            |::.|.:| |.||        |:  .||.|..:                  ..|..:.||.::.:
 Worm   312 DDVLTQILPYTHY--------DILNSCGSDASVCCEFDFKRMTHWSCPGPKPEKITNANVAAKAE 368

  Fly   267 DFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACY 331
            ..::.:..:::.|::..|::..||||:::..:...:..|..|...:|.. :||...:.:.|...|
 Worm   369 KLVNQLEKMSEMYKAPVILMMHGDDFRFDMIEEWNQQHDNFIPVFDEIN-KGSRVEIRFGTFTDY 432

  Fly   332 LNSLHEGLQTW---------PNKTQDFFPYGSDDNSYWTGYFTSRPTQKR-------FERDGNHI 380
            .|.    |:.|         |..:.|||||......|||||:|:||..||       ..|:|:.:
 Worm   433 FND----LEKWYSNNKDSEPPTVSGDFFPYMCALGDYWTGYYTTRPFFKRQGRLLHSLIRNGDIM 493

  Fly   381 LQVAKQLSVFAELNTKQQK-----EDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILG 440
            |.:.:       :|.||:|     :.||..|..:.:.|||||||||.|..|.|:|..:|:.:|: 
 Worm   494 LSMLR-------VNLKQRKIGENVKRLEAARRNLALFQHHDAITGTSKVSVMDNYSELLHASIV- 550

  Fly   441 GVNTARDGLRK-----LTNLPNG-EFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRV 499
            ..|...:.|.|     ...:.:| |.::.:.|..||    |:      :.::|......|...::
 Worm   551 STNIVLENLTKSDIDLYPRIHDGIELQTIVDLESSE----KE------IRIFNSHLFEITDVFKI 605

  Fly   500 PVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHE---LVFKASVDKIANYYIK----- 556
            .|| |...:....|:::.:::.|.        |:.:..:.:   |:|:|:|..::...:|     
 Worm   606 RVK-EREVIVSIDGKIIEAQLEPF--------FQKSKVEKDSFLLLFQATVLPLSMMKVKVQRGD 661

  Fly   557 -----KVASQETKN-----------VAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDD 605
                 |:|..|.|:           :|:.|.:        .|||.|  :.||.:           
 Worm   662 SGGLTKMAKIEAKDTNAWDLGSSWTIASSTSA--------PNLETP--YFKVSN----------- 705

  Fly   606 EGETVVQTSQVKLVIDNKTGLLKTVEMNGVSEN----IDQSYGVYRTYDSGAYVFRQYHQADFIV 666
                           |..||.:::|  |.:|:|    ..||:..|:....|||:.|.:.....|:
 Worm   706 ---------------DPITGAIQSV--NKLSDNSKFHCQQSFYNYKEAGGGAYLMRLHTNPKEII 753

  Fly   667 QYEGVEFTVYDGALVKEVHQQFSEYISQV-IRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNS 730
            :|:.::.:   |.|.:.::|:.:..:.:: |...||.:..|::..:. |:..:|...|::..| |
 Worm   754 EYQWLKVS---GPLRQSIYQKSTNVLQRLSIHNVEGPSGEEVDISMS-IDITKERNTELMTRF-S 813

  Fly   731 TIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQ 795
            |.....::||||.|.::::|          ...:.|..:||||:.:...||..|:|::::::...
 Worm   814 TKWDKPLTYTDSVGMQLLRR----------DFYKLPVQSNYYPMPTAAVLQSGKQRLSIVSNVEH 868

  Fly   796 GGASMLNGQLELMLHRRLVRDDGYGVG---EALNEEKYGQPMIARGKVYLILSPSD--------- 848
            |...:.:|.:|:.:.|.|.:|||.|:|   :|:..:.  :|:..:.|:......||         
 Worm   869 GARFLESGTVEINIDRILNQDDGKGLGTGPDAIPIDM--KPVDMKFKLIFDSLESDPTENSRYST 931

  Fly   849 ESTAAEREAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFND-----FPKSVHLLTLEPFNDDEVLL 908
            .|..|::..:..|:.|.  .|::    .....:.:....:     ||..:.|||:.|..|::.||
 Worm   932 HSFRAQQAVQTIIYPPM--MFNR----PPKKEEDIEEIEEISNLKFPCDIQLLTVRPLEDNKQLL 990

  Fly   909 ------------RVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDG-----------NLPLS 950
                        :|.|.....:..::...|:     |...::::|.|.|           .||..
 Worm   991 ILYRHATVCSSQKVGNCGGELKSSLMDLLIK-----LGAKQVQKTDLSGVTRVGGIIKVEYLPDY 1050

  Fly   951 DMKRFKF 957
            ::|.|.|
 Worm  1051 ELKTFDF 1057

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 78/296 (26%)
Alpha-mann_mid 359..434 CDD:286360 33/87 (38%)
Glyco_hydro_38C 482..1002 CDD:285047 110/546 (20%)
aman-3NP_001021474.1 GH38N_AMII_GMII_SfManIII_like 136..470 CDD:212120 97/358 (27%)
Alpha-mann_mid 465..545 CDD:214875 33/87 (38%)
Glyco_hydro_38C 696..1055 CDD:303346 88/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.