DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2b2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_032576.2 Gene:Man2b2 MGIID:1195262 Length:1018 Species:Mus musculus

Alignment Length:1094 Identity:300/1095 (27%)
Similarity:460/1095 (42%) Gaps:231/1095 (21%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            |...:|||||.||||:.||.:....:.:|        :..||:|||::...||||.||..||..|
Mouse    27 IRAFVVPHSHMDVGWVFTVQESMRAYAAN--------VYTTVVAELVRGGQRRFIAVEQEFFRLW 83

  Fly   103 W-AEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRI 166
            | ...||..||.||:|::||||||..|...|:|||..:....|.|.|.|..||.:|||  .||:.
Mouse    84 WDGVASEQQKQQVRQLLHEGRLEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFG--IRPQF 146

  Fly   167 GWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGM-EMIWDASDSLS-NDEIFTGL 229
            .|.:||||.|....::||..|::....:|:|: |..|.:....| :.:|..|.||| ..||||.:
Mouse   147 SWHVDPFGASATTPTLFALAGFNAHLISRIDY-DLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHV 210

  Fly   230 LYRHYSAPPGYCFDVHC----------------------GDDPIIDTKSYDNNVKSRVDDFLSYV 272
            : .|||    ||...|.                      |..|.:.......|:....:..::.|
Mouse   211 M-DHYS----YCTPSHIPFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANV 270

  Fly   273 TSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHE 337
            ...|..:|:.|::.|.|.|.|:.:|.|.|.|||.|:.|:|:|.|:.. .::.|:|...|..:||.
Mouse   271 KQRAAWFRTPHVLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFG-ISVQYATLNDYFQALHA 334

  Fly   338 GLQTWPNKT-QDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE--------- 392
            ...||..:. |||.||.|:....|||::|||.|.|...|..:.:|...:  |:|..         
Mouse   335 TNMTWGIRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGE--SMFTRYMWPDPSGT 397

  Fly   393 LNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYD-----------RILYDAILGGVNTAR 446
            |:.....:.|:.||..:..:||||||||||...|.:.|.           :::....|||...:.
Mouse   398 LDPTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGPPGSG 462

  Fly   447 DGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDE 511
            .|..|  ::...:....|.::.....::        .::|||||...|..:.:.|...|..||||
Mouse   463 TGAPK--DIMGPQVTPVLSVDTRPVGYS--------ASVYNPLAWKITTIITLTVAFPNVSVTDE 517

  Fly   512 KGRVVASEVV-----PVAWQVL------ALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKN 565
            .|..|::::.     |.|:.:|      .|.:|:....|                          
Mouse   518 LGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYRHYQVMH-------------------------- 556

  Fly   566 VAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLL--- 627
                   .|..:|....|..|:......|||...:...:.:....|......|:.|..|.:|   
Mouse   557 -------ARGDQAGTRELVAPRANTLKFSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSI 614

  Fly   628 ------KTVEMNGVSENIDQSYGVYRTYDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQ 686
                  :||.|.........::.|.:...|..|:|...:.|:  ..:|.|...:..|.||.::.|
Mouse   615 QDRQSNRTVRMTQEFLEYQANWDVKQGPISDNYLFAPNNTAE--PSWEAVGMEMVAGTLVTDIRQ 677

  Fly   687 QFSEYISQVIRIYE-----------GKNL---VEIEWQVGPIEREEEFGREVVIIFNSTIASDGV 737
            .|..||:....||.           |:.|   :|.:::|||:    :..||.::..:|.:.|..|
Mouse   678 YFYRYITDQEYIYSIHTRLAHPSLAGELLCQRIEQQYRVGPL----DLNREAILRTSSDLNSQQV 738

  Fly   738 SYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLN 802
            .|:|:||.:|      ||..: ......|...||||:.....::|.|.|:.:|.:|..|.:|..|
Mouse   739 LYSDNNGYQM------QRRPY-KAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGN 796

  Fly   803 GQLELMLHRR----LVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAE--------- 854
            ||:|:|||||    |..|..|.:  .||:.....|::     :|:|.|....||..         
Mouse   797 GQVEVMLHRRLWNNLAWDLKYNL--TLNDTSIVHPVL-----WLMLGPKSTMTALHPRSGVALQH 854

  Fly   855 ---------REAEKEIHLPFWKFFSKNTGSTTAAAK------SVPSFNDFPKS--VHLLTLE--- 899
                     .:.|..:|.|      .|....|....      |||.:. :.:|  .||..|:   
Mouse   855 GPVVLLKELADEETPVHGP------HNPWPVTLPPNLHLQILSVPGWT-YSRSHAQHLRNLQRGH 912

  Fly   900 ----PFNDDEVLLRVENFLDHTEGQVVSFNIRP----IFDYLNG----VEIRETTLDGNLPLSDM 952
                ..|...||||:.:..:..|..|:|   ||    :...|.|    |.:.|.:|.|...:..:
Mouse   913 PEKPQANLQRVLLRLRHLYEAGEDPVLS---RPATVDLKVVLRGLGSVVAVEERSLTGTWDVQML 974

  Fly   953 KRFKFHHDSSGQKPDAVE-YFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            :|:   |.|:  |.|.:: :.||..:|....        .:|::|.:||||.||
Mouse   975 QRW---HWST--KTDHLKGHPTSPPRPPGGS--------IITVYPKEIRTFFIK 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 105/299 (35%)
Alpha-mann_mid 359..434 CDD:286360 28/95 (29%)
Glyco_hydro_38C 482..1002 CDD:285047 142/600 (24%)
Man2b2NP_032576.2 GH38N_AMII_Epman_like 27..352 CDD:212122 120/342 (35%)
Alpha-mann_mid 358..439 CDD:214875 28/83 (34%)
Glyco_hydro_38C 491..1012 CDD:285047 142/597 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.