DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2b1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_006530810.1 Gene:Man2b1 MGIID:107286 Length:1024 Species:Mus musculus

Alignment Length:1044 Identity:410/1045 (39%)
Similarity:583/1045 (56%) Gaps:108/1045 (10%)


  Fly     9 LFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGH---------- 63
            ||..|||   .|...|.||:.||.||..|:|:|::||:|||||||||||||:||.          
Mouse    37 LFWLLLA---APGARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDLDFLNFMPT 98

  Fly    64 -RSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTG 127
             .|::|||.||||:|:|::.|::.|.||||.||.:||::||.:|:...:..||.||.:|||||..
Mouse    99 VLSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVN 163

  Fly   128 GAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEF 192
            |.|.||||||.:|.:::||.||||:||.|||||...||:.|.||||||||||||:|||||:||.|
Mouse   164 GGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFF 228

  Fly   193 FARMDHRDKNDRIDNLGMEMIWDASDSLSND--EIFTGLLYRHYSAPPGYCFDVHCGDDPIIDT- 254
            ..|:|::||.:|...|.||.:|.|||||...  ::|||:|..:|:.|...|:||.|.|.|::|. 
Mouse   229 LGRIDYQDKLNRKKKLRMEELWRASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNP 293

  Fly   255 KSYDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGS 319
            :|.:.|.|:.|:.||...:|....||:||.::.||.||.||:|.:.||||||||:.||.:|..||
Mouse   294 RSPEFNAKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGS 358

  Fly   320 TFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVA 384
            ..::.||||.|||..|::...||..|..|||||....:.:|||||:|||..||:||...:.|||.
Mouse   359 LVHVLYSTPTCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVC 423

  Fly   385 KQLS--VFAELNT-KQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDA-----ILGG 441
            .||.  |..|.|. .....|...|:|.|.|:|||||::||.:|:|.:||.|.|...     :|  
Mouse   424 NQLEALVGPEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVL-- 486

  Fly   442 VNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENY 506
               ..:.|.:|::... .|..|.:||||.|..:: .::...|||||||.....|.||:||...|:
Mouse   487 ---VSNALARLSHYKQ-NFSFCRELNISICPVSQ-TSERFQVTLYNPLGRKVDQMVRLPVYEGNF 546

  Fly   507 EVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTK 571
            .|.|...:.::|.||.|.      .:.:...|.||:|.|||..: .:....||.....|..||..
Mouse   547 IVKDPHDKNISSNVVMVP------SYYSETYQWELLFPASVPAL-GFSTYSVAKMSDLNHQAHNL 604

  Fly   572 SKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVE--MNG 634
            ..|           |::.|..|.|              |::...::...|:.||||..:|  ...
Mouse   605 LSR-----------PRKHKSHHVL--------------VIENKYMRATFDSGTGLLMKIENLEQN 644

  Fly   635 VSENIDQSYGVYR--------TYDSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEY 691
            :|..:.|.:..|.        :..||||:||. :....|......:.::...|||:||||.||.:
Mouse   645 LSLPVSQGFFWYNASVGDEESSQASGAYIFRP-NVGKPIPVSRWAQISLVKTALVQEVHQNFSAW 708

  Fly   692 ISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRE 756
            .|||||:|:|:..:|:||.||||...:::|:||:..|::.:.:.|..:|||||||::||..|.|.
Mouse   709 CSQVIRLYKGQRHLELEWTVGPIPVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRP 773

  Fly   757 TFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGV 821
            |:|.. ..:|.|.|||||.:||.:.|.:.::.||.||:|||:|:.:|.||||:||||:.||..||
Mouse   774 TWTLN-QTEPVAGNYYPVNTRIYITDGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGV 837

  Fly   822 GEALNEEKYGQPMIARGKVYLILSPSDESTAAER-EAEKEIHLPFWKFFSKNTGSTTAAAKSVPS 885
            .|.|.|...|..:  ||:..::||...::.|..| .||:|:..|  :......||:...:::.|.
Mouse   838 SEPLLETDTGDKV--RGRHLVLLSSVSDAAARHRLLAEQEVLAP--QVVLSLGGSSPYHSRATPK 898

  Fly   886 F------NDFPKSVHLLTLEPFNDDEVLLRVENFL------DHTEGQVVSFNIRPIFDYLNGVEI 938
            .      .:.|..||||||..:....:|||:|:..      |......|:.|::.:|.......:
Mouse   899 TQFSGLRQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYL 963

  Fly   939 RETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFI 1003
            :||||..|.|||...|.|:..::.               |.:..:..:....||||.||:||||:
Mouse   964 QETTLAANQPLSRASRLKWMTNTG---------------PTSYPEPSKLDPTSVTLKPMEIRTFL 1013

  Fly  1004 IKTE 1007
            ...:
Mouse  1014 ASVQ 1017

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 150/288 (52%)
Alpha-mann_mid 359..434 CDD:286360 37/78 (47%)
Glyco_hydro_38C 482..1002 CDD:285047 177/543 (33%)
Man2b1XP_006530810.1 GH38N_AMII_LAM_like 63..352 CDD:212121 151/289 (52%)
Alpha-mann_mid 398..476 CDD:214875 37/78 (47%)
Glyco_hydro_38C 521..1012 CDD:285047 177/544 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64844551
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T616153
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.710

Return to query results.
Submit another query.