DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2a1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_032575.2 Gene:Man2a1 MGIID:104669 Length:1150 Species:Mus musculus

Alignment Length:1089 Identity:271/1090 (25%)
Similarity:457/1090 (42%) Gaps:228/1090 (21%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.|||||.:.||        ....|||.:.::.:|.:|.:|:|:..|.|:.|||
Mouse   165 LQVFVVPHSHNDPGWLKTFNDYF--------RDKTQYIFNNMVLKLKEDSSRKFMWSEISYLAKW 221

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |.......|:.|:.|:..|:||...|.|.|.|||..:|.::|||...|.::|:...|  .:||.|
Mouse   222 WDIIDIPKKEAVKSLLQNGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLG--VKPRSG 284

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS-DSLSNDEIFTGLLY 231
            |.|||||||...|.:..:.|:......|:.:..|.....:..:|..|..: |..|..:|...:: 
Mouse   285 WAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMM- 348

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|: | ||.||.|    |.|..                 ..||:||....|....
Mouse   349 ------PFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYR 407

  Fly   274 SVAQHYRSNHIMIPMGDDF---QYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSL 335
            ..::.:|:..::.|:||||   :|.:..:..:|.::|..|:|.:  ......:.:.|.:.|.::|
Mouse   408 KKSKLFRTKVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQ--PHLKVKIQFGTLSDYFDAL 470

  Fly   336 HEGL--------QTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE 392
            .:.:        ..:|..:.|||.|...|:.||:|||||||..||.:|.....::.|:   :..:
Mouse   471 EKAVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAE---ILYQ 532

  Fly   393 LNTKQQKE-------------DLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNT 444
            |..||.::             .|...|..:|:.|||||||||.|..|..||...|:.::      
Mouse   533 LALKQAQKYKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSL------ 591

  Fly   445 ARDGLRKLTNLPNGEFESCLQLNISE---------CAFTKDDA---------DNVVVTL------ 485
              :.|.|:..      :|...|.:.:         .||.:.|.         ..:::.|      
Mouse   592 --NSLEKIIG------DSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPR 648

  Fly   486 ----YNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRN-NDTQHELVFKA 545
                |||........|.:.|.:...:|..:.|:.|..:|..| |.    :.|. :...:|:.|.|
Mouse   649 YLVVYNPFEQERHSVVSIRVNSATVKVLSDSGKPVEVQVSAV-WN----DMRTISQAAYEVSFLA 708

  Fly   546 SVDKIANYYIKKVASQ-ETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGET 609
            .:..:.....|.:.|| .:.::|.:........||..          :..:||..     |.|:.
Mouse   709 HIPPLGLKVFKILESQSSSSHLADYVLYNNDGLAENG----------IFHVKNMV-----DAGDA 758

  Fly   610 VVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQS-----YGVYRTYD-SGAYVFRQYHQADFIVQY 668
            :...:....:..:::||::.|.....|...:..     ||.....| ||||:|....|....|..
Mouse   759 ITIENPFLAIWFDRSGLMEKVRRKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSL 823

  Fly   669 EGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIER----EEEFGREVVIIFN 729
            ......|..|.:..:| ..|.|:::..:|:|   |:..||.|...:..    .....||:|:..:
Mouse   824 RPPFVRVTRGRIYSDV-TCFLEHVTHKVRLY---NIQGIEGQSMEVSNIVNIRNVHNREIVMRIS 884

  Fly   730 STIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRA 794
            |.|.:....|||.||.::     ..|.|    :.:.|..||.||:.:...:||::.|:.:|:.::
Mouse   885 SKINNQNRYYTDLNGYQI-----QPRRT----MSKLPLQANVYPMCTMAYIQDAEHRLTLLSAQS 940

  Fly   795 QGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEK 859
            .|.:||.:||:|:.:.|||::||..|:|:.:::.|      ....::.||  .::.:|...|.||
Mouse   941 LGASSMASGQIEVFMDRRLMQDDNRGLGQGVHDNK------ITANLFRIL--LEKRSAVNMEEEK 997

  Fly   860 EIHLPFWKFFSKNTGS---------TTAAAKSVPSF----------NDFPKSVHLLTL------- 898
            :..:.:....|..|.|         ..:.....|:|          :..|..:||:.|       
Mouse   998 KSPVSYPSLLSHMTSSFLNHPFLPMVLSGQLPSPAFELLSEFPLLQSSLPCDIHLVNLRTIQSKM 1062

  Fly   899 -EPFNDDEVLLRVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRF-KFHHDS 961
             :.::|:..|:.      |.:|....|:.|       |:.:..:|..|.  :|.:|.| ||    
Mouse  1063 GKGYSDEAALIL------HRKGFDCQFSSR-------GIGLPCSTTQGK--MSVLKLFNKF---- 1108

  Fly   962 SGQKPDAVEYFTSA-----HKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
                  |||....:     |.|..|:...|     |:|.||:|.||.|:
Mouse  1109 ------AVESLVPSSLSLMHSPPDAQNMSE-----VSLSPMEISTFRIR 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 91/301 (30%)
Alpha-mann_mid 359..434 CDD:286360 32/88 (36%)
Glyco_hydro_38C 482..1002 CDD:285047 128/575 (22%)
Man2a1NP_032575.2 PLN02701 127..1148 CDD:178304 271/1090 (25%)
GH38N_Man2A1 164..507 CDD:212131 105/361 (29%)
Alpha-mann_mid 502..587 CDD:214875 32/88 (36%)
Glyco_hydro_38C 757..1143 CDD:285047 102/437 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.