DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and Man2a2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_766491.2 Gene:Man2a2 MGIID:2150656 Length:1152 Species:Mus musculus

Alignment Length:1125 Identity:299/1126 (27%)
Similarity:471/1126 (42%) Gaps:291/1126 (26%)


  Fly    35 TNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFF 99
            |..:.:.:|||||:|.||:||.|:|:...        .|:|:::::::|.:||.|||:..|.|||
Mouse   163 TEDLQVFVVPHSHNDPGWIKTFDKYYTEQ--------TQHILNSMVSKLQEDPRRRFLWAEVSFF 219

  Fly   100 AKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARP 164
            ||||...|...:..||:||..|:||...|.|.|.|||..:|.:::||...|.::|:...|  |.|
Mouse   220 AKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLG--ATP 282

  Fly   165 RIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW-DASDSLSNDEIFTG 228
            |.||.:||||||.....:..:.........|:.:..|........:|.:| ...||.|:.:||..
Mouse   283 RSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCH 347

  Fly   229 LLYRHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLS 270
            ::       |.|.:|| | ||.||.|    |.|..                 :.||..|....|.
Mouse   348 MM-------PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLD 405

  Fly   271 YVTSVAQHYRSNHIMIPMGDDFQYE-----DAQVNFKNMDKLIKYVNER-----QAEGSTFNLFY 325
            .....::.:|||.:::|:||||:|:     |||  |.|..:|..::|.:     ||:       :
Mouse   406 QYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFLNSKPEFHVQAQ-------F 461

  Fly   326 STPACYLNSLHE--GLQT------WPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFER------D 376
            .|.:.|.::|::  |::.      :|..:.|||.|...::.|||||:||||..|..:|      .
Mouse   462 GTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLR 526

  Fly   377 GNHILQ-----------VAKQ--LSVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSD 428
            |..||.           :|.|  ||.||.|..         .|..:|:.|||||||||.|:.|..
Mouse   527 GAEILYSLALAHARRSGLAGQYPLSDFALLTE---------ARRTLGLFQHHDAITGTAKEAVVV 582

  Fly   429 DYDRILYDAILGGVNTARDGLRKLTNLPN-----------GEFES--------CLQLN------- 467
            ||          ||..    ||.|.:|..           |:.|:        .||::       
Mouse   583 DY----------GVRL----LRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHD 633

  Fly   468 -ISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVV----------ASEVV 521
             :.|....:.|:....|.::|||.......|.:.|.:....|..|:|:.:          |:::|
Mouse   634 ALPERTVIRLDSSPRFVVVFNPLEQERLSVVSLLVNSPRVRVLSEEGQPLSVQISVHWSSATDMV 698

  Fly   522 PVAWQV----------LALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSI 576
            |..:||          |.:.....|.......::||    ..|:..|              |.|:
Mouse   699 PDVYQVSVPVRLPGLGLGVLQLQPDLDGPYTLQSSV----RVYLNGV--------------KLSV 745

  Fly   577 KAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQ 641
            ..:.|   .|.|            ..|....:..:....:::.....|||||::..  |.|..:|
Mouse   746 SRQSA---FPVR------------VVDSGASDFAISNRYMQVWFSGLTGLLKSIRR--VDEEQEQ 793

  Fly   642 S-------YGVYRTYD-SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRI 698
            .       ||...:.| ||||:|....:|...|..:.....|.:|....|| ..:.|:..||||:
Mouse   794 QMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPFFSEV-AVYYEHFHQVIRL 857

  Fly   699 Y-----EGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNG-----REMIKRVKD 753
            |     ||.:| ::.:||   :..:...:|:.:..::.|.|.|..:||.||     |:.:|::  
Mouse   858 YNLPGVEGLSL-DMSFQV---DIRDYVNKELALRIHTDIDSQGTFFTDLNGFQIQPRQYLKKL-- 916

  Fly   754 QRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDG 818
                        |..||:||:.....:|||::|:.:...:|.|.:|:.|||||::|.|||::||.
Mouse   917 ------------PLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQLEVILDRRLMQDDN 969

  Fly   819 YGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEKE-----------IHL--------P 864
            .|:|:.|.:.|     |...:..|:|   :..|....|..:|           .||        |
Mouse   970 RGLGQGLKDNK-----ITCNRFRLLL---ERRTTMSPEVHQEQERSTSYPSLLSHLTSMYLSTPP 1026

  Fly   865 FWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLE--------PFNDDEVLLRVENFLDHTEGQV 921
            .....:|..|::.|.....|..:..|...|||.|.        |..|..::|..:.|....|.:.
Mouse  1027 LVLPVAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSALILHRKGFDCGLEAKN 1091

  Fly   922 VSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHH-DSSGQKPDAVEYFTSAHKPLAAEQSQ 985
            :.||.              ||..|.|.|..:    ||. |.:..:|.::...    .|||:    
Mouse  1092 LGFNC--------------TTSQGKLALGSL----FHGLDVTFLQPTSLTLL----YPLAS---- 1130

  Fly   986 EASEFSVTLHPMQIRTFIIK 1005
            .::...::|.||:|.||.::
Mouse  1131 PSNSTDISLEPMEISTFRLR 1150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 99/303 (33%)
Alpha-mann_mid 359..434 CDD:286360 36/94 (38%)
Glyco_hydro_38C 482..1002 CDD:285047 138/586 (24%)
Man2a2NP_766491.2 PLN02701 140..1151 CDD:178304 299/1126 (27%)
CE4_SF 165..508 CDD:301698 116/369 (31%)
Alpha-mann_mid 503..588 CDD:214875 38/104 (37%)
Glyco_hydro_38C 752..1147 CDD:285047 115/462 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.